PDB entry 4he7

View 4he7 on RCSB PDB site
Description: Crystal Structure of Brazzein
Class: plant protein
Keywords: Sweet-Tasting Protein, PLANT PROTEIN
Deposited on 2012-10-03, released 2013-03-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Defensin-like protein
  Species: Pentadiplandra brazzeana [TaxId:43545]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P56552 (0-53)
  Domains in SCOPe 2.08: d4he7a_
• Heterogens: NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4he7A (A:)
  edkckkvyenypvskcqlanqcnydckldkharsgecfydekrnlqcicdycey