PDB entry 4he4

View 4he4 on RCSB PDB site
Description: Crystal structure of the yellow fluorescent protein phiYFP (Phialidium sp.)
Class: fluorescent protein
Keywords: phiYFP, yellow fluorescent protein, mutant variant of phiYFP, Thr-Tyr-Gly chromophore, beta-barrel, Biomarker, Thr-Tyr-Gly bicyclic chromophore, FLUORESCENT PROTEIN
Deposited on 2012-10-03, released 2013-05-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.199
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: yellow fluorescent protein
    Species: Phialidium sp. SL-2003 [TaxId:258839]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6RYS7 (1-232)
      • expression tag (0)
      • chromophore (64)
      • see remark 999 (87)
      • see remark 999 (102)
      • see remark 999 (165)
      • see remark 999 (173)
      • see remark 999 (200-201)
      • see remark 999 (205)
      • see remark 999 (220)
      • see remark 999 (233)
    Domains in SCOPe 2.03: d4he4a_
  • Chain 'B':
    Compound: yellow fluorescent protein
    Species: Phialidium sp. SL-2003 [TaxId:258839]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6RYS7 (1-232)
      • expression tag (0)
      • chromophore (64)
      • see remark 999 (87)
      • see remark 999 (102)
      • see remark 999 (165)
      • see remark 999 (173)
      • see remark 999 (200-201)
      • see remark 999 (205)
      • see remark 999 (220)
      • see remark 999 (233)
    Domains in SCOPe 2.03: d4he4b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4he4A (A:)
    gssgallfhgkipyvvemegnvdghtfsirgkgygdasvgkvdaqficttgdvpvpwstl
    vttlgygaqcfakygpelkdfykscmpdgyvqertitfegdgnfktraevtfengsvynr
    vklngqgfkkdghvlgknlefnftphclyiwgdqanhglksafkicheitgskgdfivad
    htqmntpigggpvhvpeyhhmsyhvklskdvtdhrdnmslketvravdcrktydfdagsg
    dtslis
    

    Sequence, based on observed residues (ATOM records): (download)
    >4he4A (A:)
    gssgallfhgkipyvvemegnvdghtfsirgkgygdasvgkvdaqficttgdvpvpwstl
    vttlgygaqcfakygpelkdfykscmpdgyvqertitfegdgnfktraevtfengsvynr
    vklngqgfkkdghvlgknlefnftphclyiwgdqanhglksafkicheitgskgdfivad
    htqmntpigggpvhvpeyhhmsyhvklskdvtdhrdnmslketvravdcrktyd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4he4B (B:)
    gssgallfhgkipyvvemegnvdghtfsirgkgygdasvgkvdaqficttgdvpvpwstl
    vttlgygaqcfakygpelkdfykscmpdgyvqertitfegdgnfktraevtfengsvynr
    vklngqgfkkdghvlgknlefnftphclyiwgdqanhglksafkicheitgskgdfivad
    htqmntpigggpvhvpeyhhmsyhvklskdvtdhrdnmslketvravdcrktydfdagsg
    dtslis
    

    Sequence, based on observed residues (ATOM records): (download)
    >4he4B (B:)
    gssgallfhgkipyvvemegnvdghtfsirgkgygdasvgkvdaqficttgdvpvpwstl
    vttlgygaqcfakygpelkdfykscmpdgyvqertitfegdgnfktraevtfengsvynr
    vklngqgfkkdghvlgknlefnftphclyiwgdqanhglksafkicheitgskgdfivad
    htqmntpigggpvhvpeyhhmsyhvklskdvtdhrdnmslketvravdcrktyd