PDB entry 4hde

View 4hde on RCSB PDB site
Description: The crystal structure of a SCO1/SenC family lipoprotein from Bacillus anthracis str. Ames
Class: lipid binding protein
Keywords: structural genomics, The Center for Structural Genomics of Infectious Diseases, CSGID, NIAID, National Institute of Allergy and Infectious Diseases, LIPID BINDING PROTEIN
Deposited on 2012-10-02, released 2012-10-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-10-24, with a file datestamp of 2012-10-19.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: 0.163
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SCO1/SenC family lipoprotein
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS2093, BA_2249, GBAA_2249
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81R11 (3-169)
      • expression tag (2)
    Domains in SCOPe 2.06: d4hdea1, d4hdea2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4hdeA (A:)
snalrkplnwdletfqftnqdgkpfgtkdlkgkvwvadfmftncqtvcppmtanmaklqk
makeekldvqfvsfsvdpdldkpenlkafiqkftedtsnwnlltgysleditkfskdnfq
slvdkpengqvihgtsfylidqngkvmkkysgisntpyediirdmkrlae

    Sequence, based on observed residues (ATOM records): (download) 
    >4hdeA (A:)
alrkplnwdletfqftnqdgkpfgtkdlkgkvwvadfmftncqtvcppmtanmaklqkma
keekldvqfvsfsvdpdldkpenlkafiqkftedtsnwnlltgysleditkfskdnfqsl
vdkpengqvihgtsfylidqngkvmkkysgisntpyediirdmkrlae