PDB entry 4hd9

View 4hd9 on RCSB PDB site
Description: Crystal structure of native human MAdCAM-1 D1D2 domain
Class: immune system
Keywords: immunoglobulin superfamily, rolling and firm adhesion, integrin alpha4beta7, IMMUNE SYSTEM
Deposited on 2012-10-02, released 2013-01-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.175
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mucosal addressin cell adhesion molecule 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MADCAM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13477 (0-202)
      • engineered mutation (93)
    Domains in SCOPe 2.06: d4hd9a1, d4hd9a2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hd9A (A:)
    vkplqveppepvvavalgasrqltcrlacadrgasvqwrgldtslgavqsdtgrsvltvr
    naslsaagtrvcvgscggrtfqhtvqllvyafpnqltvspaalvpgdpevactahkvtpv
    dpnalsfsllvggqelegaqalgpevqeeeeepqgdedvlfrvterwrlpplgtpvppal
    ycqatmrlpglelshrqaipvlhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hd9A (A:)
    vkplqveppepvvavalgasrqltcrlacadrgasvqwrgldtslgavqsdtgrsvltvr
    naslsaagtrvcvgscggrtfqhtvqllvyafpnqltvspaalvpgdpevactahkvtpv
    dpnalsfsllvggqelegaqalgpevqeeeeedvlfrvterwrlpplgtpvppalycqat
    mrlpglelshrqaipvlh