PDB entry 4hd0

View 4hd0 on RCSB PDB site
Description: Mre11 ATLD17/18 mutation retains Tel1/ATM activity but blocks DNA double-strand break repair
Class: DNA binding protein
Keywords: nuclease enzyme, double-strand break repair, Rad50, NBS1, mutation L204R, DNA BINDING PROTEIN
Deposited on 2012-10-01, released 2012-10-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-01-02, with a file datestamp of 2012-12-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.225
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA double-strand break repair protein mre11
    Species: Pyrococcus furiosus [TaxId:186497]
    Gene: mre11, PF1166
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U1N9 (6-End)
      • engineered mutation (209)
    Domains in SCOPe 2.04: d4hd0a_
  • Chain 'B':
    Compound: DNA double-strand break repair protein mre11
    Species: Pyrococcus furiosus [TaxId:186497]
    Gene: mre11, PF1166
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U1N9 (6-End)
      • engineered mutation (209)
    Domains in SCOPe 2.04: d4hd0b_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hd0A (A:)
    hhhhhhmkfahladihlgyeqfhkpqreeefaeafknaleiavqenvdfiliagdlfhss
    rpspgtlkkaiallqipkehsipvfaiegnhdrtqrgpsvlnlledfglvyvigmrkekv
    eneyltserlgngeylvkgvykdleihgmkymssawfeankeilkrlfrptdnailmlhq
    gvrevseargedyfeiglgdlpegylyyarghihkryetsysgspvvypgslerwdfgdy
    evryewdgikfkerygvnkgfyivedfkprfveikvrpfidvkikgseeeirkaikrlip
    lipknayvrlnigwrkpfdlteikellnveylkidtwri
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hd0A (A:)
    mkfahladihlgyeqfhkpqreeefaeafknaleiavqenvdfiliagdlfhssrpspgt
    lkkaiallqipkehsipvfaiegnhdrtqrgpsvlnlledfglvyvigmrkekveneylt
    serlgngeylvkgvykdleihgmkymssawfeankeilkrlfrptdnailmlhqgvrevs
    eargedyfeiglgdlpegylyyarghihkryetsysgspvvypgslerwdfgdyevryew
    dgikfkerygvnkgfyivedfkprfveikvrpfidvkikgseeeirkaikrliplipkna
    yvrlnigwrkpfdlteikellnveylkidtwr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hd0B (B:)
    hhhhhhmkfahladihlgyeqfhkpqreeefaeafknaleiavqenvdfiliagdlfhss
    rpspgtlkkaiallqipkehsipvfaiegnhdrtqrgpsvlnlledfglvyvigmrkekv
    eneyltserlgngeylvkgvykdleihgmkymssawfeankeilkrlfrptdnailmlhq
    gvrevseargedyfeiglgdlpegylyyarghihkryetsysgspvvypgslerwdfgdy
    evryewdgikfkerygvnkgfyivedfkprfveikvrpfidvkikgseeeirkaikrlip
    lipknayvrlnigwrkpfdlteikellnveylkidtwri
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hd0B (B:)
    mkfahladihlgyeqfhkpqreeefaeafknaleiavqenvdfiliagdlfhssrpspgt
    lkkaiallqipkehsipvfaiegnhdrtqrgpsvlnlledfglvyvigmrkekveneylt
    serlgngeylvkgvykdleihgmkymssawfeankeilkrlfrptdnailmlhqgvrefe
    iglgdlpegylyyarghihkryetsysgspvvypgslerwdfgdyevryewdgikfkery
    gvnkgfyivedfkprfveikvrpfidvkikeirkaikrliplipknayvrlnigwrkpfd
    lteikellnveylkidtwr