PDB entry 4hcq

View 4hcq on RCSB PDB site
Description: Crystal structure of GLMU from mycobacterium tuberculosis in complex with glucosamine-1-phosphate
Class: transferase
Keywords: acetyltransferase, bifunctional, pyrophosphorylase, rossmann-like fold, left-handed-beta-helix, cell shape, cell wall biogenesis/degradation, magnesium, metal-binding, multifunctional enzyme, nucleotidyltransferase, peptidoglycan synthesis, transferase, acyltransferase
Deposited on 2012-10-01, released 2013-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.202
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional protein glmU
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: glmU, Rv1018c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hcqa1, d4hcqa2
  • Heterogens: GN1, CO, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hcqA (A:)
    hhhhhhmtfpgdtavlvlaagpgtrmrsdtpkvlhtlagrsmlshvlhaiaklapqrliv
    vlghdhqriaplvgeladtlgrtidvalqdrplgtghavlcglsalpddyagnvvvtsgd
    tplldadtladliathravsaavtvltttlddpfgygrilrtqdhevmaiveqtdatpsq
    reirevnagvyafdiaalrsalsrlssnnaqqelyltdviailrsdgqtvhashvddsal
    vagvnnrvqlaelaselnrrvvaahqlagvtvvdpattwidvdvtigrdtvihpgtqllg
    rtqiggrcvvgpdttltdvavgdgasvvrthgssssigdgaavgpftylrpgtalgadgk
    lgafvevknstigtgtkvphltyvgdadigeysnigassvfvnydgtskrrttvgshvrt
    gsdtmfvapvtigdgaytgagtvvredvppgalavsagpqrnienwvqrkrpgspaaqas
    krasemacqqptqppdadqtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hcqA (A:)
    dtavlvlaagpgtrmrsdtpkvlhtlagrsmlshvlhaiaklapqrlivvlghdhqriap
    lvgeladtlgrtidvalqdrplgtghavlcglsalpddyagnvvvtsgdtplldadtlad
    liathravsaavtvltttlddpfgygrilrtqdhevmaiveqtdatpsqreirevnagvy
    afdiaalrsalsrlssnnaqqelyltdviailrsdgqtvhashvddsalvagvnnrvqla
    elaselnrrvvaahqlagvtvvdpattwidvdvtigrdtvihpgtqllgrtqiggrcvvg
    pdttltdvavgdgasvvrthgssssigdgaavgpftylrpgtalgadgklgafvevknst
    igtgtkvphltyvgdadigeysnigassvfvnrttvgshvrtgsdtmfvapvtigdgayt
    gagtvvredvppgalavsagpqrnienwvqrk