PDB entry 4hcp

View 4hcp on RCSB PDB site
Description: crystal structure of Burkholderia pseudomallei effector protein chbp in complex with nedd8
Class: protein binding
Keywords: deamidase, Alpha/Beta/Alpha fold, Deamidation, NEDD8/Ubiquitin, bacterial cytosol, PROTEIN BINDING
Deposited on 2012-10-01, released 2012-11-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: 0.203
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative ATP/GTP binding protein
    Species: BURKHOLDERIA PSEUDOMALLEI [TaxId:272560]
    Gene: BPSS1385
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q63KH5 (Start-254)
      • engineered mutation (82)
  • Chain 'B':
    Compound: nedd8
    Species: Homo sapiens [TaxId:9606]
    Gene: NEDD8
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15843 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.05: d4hcpb_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4hcpB (B:)
aamlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaad
ykilggsvlhlvlalrgg

    Sequence, based on observed residues (ATOM records): (download) 
    >4hcpB (B:)
aamlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaad
ykilggsvlhlvlal