PDB entry 4hcn

View 4hcn on RCSB PDB site
Description: Crystal structure of Burkholderia pseudomallei effector protein CHBP in complex with ubiquitin
Class: protein binding
Keywords: ubiquitin/nedd8 deamidase, ubiquitin, nedd8, protein binding
Deposited on 2012-09-30, released 2012-11-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.222
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative ATP/GTP binding protein
    Species: BURKHOLDERIA PSEUDOMALLEI [TaxId:272560]
    Gene: BPSS1385
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q63KH5 (Start-254)
      • engineered mutation (82)
  • Chain 'B':
    Compound: Polyubiquitin
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: SCD2, UBI4, YLL039C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG63 (22-97)
      • expression tag (21)
    Domains in SCOPe 2.04: d4hcnb_
  • Heterogens: PEG, FMT, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hcnB (B:)
    mgsshhhhhhssgenlyfqgrpmqifvktltgktitlevessdtidnvkskiqdkegipp
    dqqrlifagkqledgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hcnB (B:)
    pmqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdy
    niqkestlhlvlrlrgg