PDB entry 4hck

View 4hck on RCSB PDB site
Description: human hck sh3 domain, nmr, 25 structures
Class: transferase
Keywords: sh3, protein tyrosine kinase, signal transduction, transferase
Deposited on 1998-03-09, released 1998-06-17
The last revision prior to the SCOP 1.75 freeze date was dated 1998-06-17, with a file datestamp of 2007-06-04.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hematopoietic cell kinase
    Species: HOMO SAPIENS
    Gene: RESIDUES G72-E143 OF HUMAN HCK
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d4hcka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hckA (A:)
    gireagsediivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsn
    yvarvdsletee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hckA (A:)
    sediivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvd
    s