PDB entry 4hbw

View 4hbw on RCSB PDB site
Description: Crystal Structure of the first bromodomain of human BRD4 in complex with a quinazoline ligand
Class: protein binding/inhibitor
Keywords: bromodomain,cap, hunk1, mcap, protein binding-inhibitor complex, mitotic chromosome associated protein, cell cycle, structural genomics consortium, sgc
Deposited on 2012-09-28, released 2012-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-12-12, with a file datestamp of 2012-12-07.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.177
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD4, HUNK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60885 (0-126)
      • conflict (1)
      • conflict (17)
    Domains in SCOPe 2.08: d4hbwa_
  • Heterogens: EDO, 14Z, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4hbwA (A:)
smnppppetsnpnkpkretnqlqyllrvvlktlwkhqfawpfqqpvdavklnlpdyykii
ktpmdmgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklflqki
nelptee