PDB entry 4hbq

View 4hbq on RCSB PDB site
Description: Crystal structure of a loop deleted mutant of Human MAdCAM-1 D1D2
Class: immune system
Keywords: immunoglobulin superfamily, integrin alpha4beta7, IMMUNE SYSTEM
Deposited on 2012-09-28, released 2013-01-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-05-26, with a file datestamp of 2021-05-21.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Mucosal addressin cell adhesion molecule 1
  Species: Homo sapiens [TaxId:9606]
  Gene: MADCAM1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q13477 (0-197)
    • engineered mutation (93)
    • engineered mutation (147)
    • insertion (149-152)
    • expression tag (198-205)
  Domains in SCOPe 2.08: d4hbqa1, d4hbqa2, d4hbqa3
• Chain 'B':
  Compound: Mucosal addressin cell adhesion molecule 1
  Species: Homo sapiens [TaxId:9606]
  Gene: MADCAM1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q13477 (0-197)
    • engineered mutation (93)
    • engineered mutation (147)
    • insertion (149-152)
    • expression tag (198-205)
  Domains in SCOPe 2.08: d4hbqb1, d4hbqb2, d4hbqb3
• Heterogens: SO4, GOL, NAG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4hbqA (A:)
  vkplqveppepvvavalgasrqltcrlacadrgasvqwrgldtslgavqsdtgrsvltvr
  naslsaagtrvcvgscggrtfqhtvqllvyafpnqltvspaalvpgdpevactahkvtpv
  dpnalsfsllvggqelegaqalgpevqqepiggdvlfrvterwrlpplgtpvppalycqa
  tmrlpglelshrqaipvlggenlyfq
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4hbqB (B:)
  vkplqveppepvvavalgasrqltcrlacadrgasvqwrgldtslgavqsdtgrsvltvr
  naslsaagtrvcvgscggrtfqhtvqllvyafpnqltvspaalvpgdpevactahkvtpv
  dpnalsfsllvggqelegaqalgpevqqepiggdvlfrvterwrlpplgtpvppalycqa
  tmrlpglelshrqaipvlggenlyfq