PDB entry 4hbm

View 4hbm on RCSB PDB site
Description: Ordering of the N Terminus of Human MDM2 by Small Molecule Inhibitors
Class: ligase/ligase inhibitor
Keywords: MDM2, p53, protein protein interaction, inhibitor, ligase-ligase inhibitor complex
Deposited on 2012-09-28, released 2012-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-02, with a file datestamp of 2012-12-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.22
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hbma_
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hbmb_
  • Chain 'C':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hbmc_
  • Chain 'D':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hbmd_
  • Chain 'E':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hbme_
  • Chain 'F':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hbmf_
  • Chain 'G':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hbmg_
  • Chain 'H':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hbmh_
  • Heterogens: 0Y7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hbmA (A:)
    msvptdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkr
    lydekqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessdsgtsvsen
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hbmA (A:)
    msvptdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkr
    lydekqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hbmB (B:)
    msvptdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkr
    lydekqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessdsgtsvsen
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hbmB (B:)
    vptdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrly
    dekqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4hbmC (C:)
    msvptdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkr
    lydekqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessdsgtsvsen
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hbmC (C:)
    vptdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrly
    dekqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4hbmD (D:)
    msvptdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkr
    lydekqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessdsgtsvsen
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hbmD (D:)
    svptdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrl
    yhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4hbmE (E:)
    msvptdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkr
    lydekqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessdsgtsvsen
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hbmE (E:)
    svptdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrl
    yqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4hbmF (F:)
    msvptdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkr
    lydekqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessdsgtsvsen
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hbmF (F:)
    svptdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrl
    yqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4hbmG (G:)
    msvptdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkr
    lydekqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessdsgtsvsen
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hbmG (G:)
    svptdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrl
    yhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvn
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4hbmH (H:)
    msvptdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkr
    lydekqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessdsgtsvsen
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hbmH (H:)
    vptdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrly
    hivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvn