PDB entry 4hb7

View 4hb7 on RCSB PDB site
Description: The Structure of Dihydropteroate Synthase from Staphylococcus aureus subsp. aureus Mu50.
Class: transferase
Keywords: TRANSFERASE, Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, Structures of Mtb Proteins Conferring Susceptibility to Known Mtb Inhibitors, MTBI
Deposited on 2012-09-27, released 2012-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydropteroate synthase
    Species: Staphylococcus aureus [TaxId:158878]
    Gene: folP, SAV0514
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hb7a_
  • Chain 'B':
    Compound: dihydropteroate synthase
    Species: Staphylococcus aureus [TaxId:158878]
    Gene: folP, SAV0514
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hb7b_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hb7A (A:)
    snamtktkimgilnvtpdsfsdggkfnnvetainrvkamidegadiidvggvstrpghem
    vtleeelnrvlpvveaivgfdvkisvdtfrsevaeaclklgvdmindqwaglydhrmfqi
    vakydaeiilmhngngnrdepvveemltsllaqahqakiagipsnkiwldpgigfaktrn
    eeaevmarldelvateypvllatsrkrftkemmgydttpverdevtaattaygimkgvra
    vrvhnvelnaklakgidflkenenarhnls
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hb7A (A:)
    tktkimgilnvtnnvetainrvkamidegadiidvggvstrpghemvtleeelnrvlpvv
    eaivgfdvkisvdtfrsevaeaclklgvdmindqwaglydhrmfqivakydaeiilmhng
    ngnrdepvveemltsllaqahqakiagipsnkiwldpgigfaktrneeaevmarldelva
    teypvllatsrkrftkemmgydttpverdevtaattaygimkgvravrvhnvelnaklak
    gidflkenenarh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hb7B (B:)
    snamtktkimgilnvtpdsfsdggkfnnvetainrvkamidegadiidvggvstrpghem
    vtleeelnrvlpvveaivgfdvkisvdtfrsevaeaclklgvdmindqwaglydhrmfqi
    vakydaeiilmhngngnrdepvveemltsllaqahqakiagipsnkiwldpgigfaktrn
    eeaevmarldelvateypvllatsrkrftkemmgydttpverdevtaattaygimkgvra
    vrvhnvelnaklakgidflkenenarhnls
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hb7B (B:)
    tktkimgilnvtnnvetainrvkamidegadiidvggvstrpghemvtleeelnrvlpvv
    eaivgfdvkisvdtfrsevaeaclklgvdmindqwaglydhrmfqivakydaeiilmhng
    ngnrdepvveemltsllaqahqakiagipsnkiwldpgigfaktrneeaevmarldelva
    teypvllatsrkrftkemmgydttpverdevtaattaygimkgvravrvhnvelnaklak
    gidflkenenarh