PDB entry 4ha3

View 4ha3 on RCSB PDB site
Description: Structure of beta-glycosidase from Acidilobus saccharovorans in complex with Tris
Class: hydrolase
Keywords: TIM barrel, beta-glycosidase, HYDROLASE
Deposited on 2012-09-25, released 2012-10-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-09-04, with a file datestamp of 2013-08-30.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: 0.144
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-galactosidase
    Species: Acidilobus saccharovorans [TaxId:666510]
    Gene: ASAC1390, ASAC_1390
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ha3a_
  • Heterogens: TRS, GOL, MG, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ha3A (A:)
    avtfpkdflfgwsqagfqsemgtpgsedpnsdwyawvhdreniaaglvsgdfpengpgyw
    gnyrkfhdaaqamgltaarigvewsrifprptfdvkvdaevkgddvlsvyvsegaleqld
    kmanrdainhyremfsdlrsrgitfilnlyhwplplwlhdpiairrgnlsapsgwldvrt
    viefakfsayvawklddlvymystmnepnvvwglgyaavksgfppgylclecagramknl
    vqaharaydavkaitkkpvgviyansdftpltdadreaaerakfdnrwaffdavvrgqlg
    gstrddlkgrldwigvnyytrqvvrargsgyeivpgyghgcepngvspagrpcsdfgwef
    ypeglynvlkeywdryhlpllvtengiadegdyqrpyylvshvyqvhralqdgvnvigyl
    hwsladnyewasgfskrfgllmvdystkrlhwrpsafiyreiaksraitdeiehlnsvpp
    lrglspghr