PDB entry 4h88

View 4h88 on RCSB PDB site
Description: Structure of POM1 FAB fragment complexed with mouse PrPc Fragment 120-230
Class: immune system
Keywords: C-term mouse prion protein, POM1 FAB, IMMUNE SYSTEM
Deposited on 2012-09-21, released 2013-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.201
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major prion protein
    Species: Mus musculus [TaxId:10090]
    Gene: Prnp, Prn-p, Prp
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04925
      • conflict (69)
    Domains in SCOPe 2.07: d4h88a_
  • Chain 'H':
    Compound: pom1 fab chain h
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4H88 (0-217)
  • Chain 'L':
    Compound: pom1 fab chain l
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4H88 (0-212)
    Domains in SCOPe 2.07: d4h88l1, d4h88l2
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4h88A (A:)
    vvgglggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqysnqnnfvhdcv
    nitikqhtvvtttkgenftetdvkmmervveqmcvtqyqkesqayydgrrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h88A (A:)
    lggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqysnqnnfvhdcvniti
    kqhtvvtttkgenftetdvkmmervveqmcvtqyqkesqayy
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h88L (L:)
    divltqspailsvspgervsfscrasqnigtsihwyqqrtnesprliikyasesisgips
    rfsgsgsgtdftlsinsvesediadyycqqsntwpytfgggtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnsetdqdskdstysmsstlt
    ltkdeyerhntytceathktstspivksfnrne