PDB entry 4h84

View 4h84 on RCSB PDB site
Description: Crystal structure of the catalytic domain of Human MMP12 in complex with a selective carboxylate based inhibitor.
Class: hydrolase/hydrolase inhibitor
Keywords: selective carboxylate based MMP-12 inhibitor, METZINCIN, Zinc protease, hydrolase-hydrolase inhibitor complex
Deposited on 2012-09-21, released 2013-04-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-08-12, with a file datestamp of 2015-08-07.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Macrophage metalloelastase
  Species: Homo sapiens [TaxId:9606]
  Gene: HME, MMP12
  Database cross-references and differences (RAF-indexed):
  • Uniprot P39900 (1-158)
    • initiating methionine (0)
    • engineered mutation (66)
  Domains in SCOPe 2.06: d4h84a1, d4h84a2
• Chain 'B':
  Compound: Macrophage metalloelastase
  Species: Homo sapiens [TaxId:9606]
  Gene: HME, MMP12
  Database cross-references and differences (RAF-indexed):
  • Uniprot P39900 (1-158)
    • initiating methionine (0)
    • engineered mutation (66)
  Domains in SCOPe 2.06: d4h84b1, d4h84b2
• Heterogens: ZN, CA, Y38, PGO, PGR, GOL, PEG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4h84A (A:)
  mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
  rgahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
  glghssdpkavmfptykyvdintfrlsaddirgiqslyg
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4h84B (B:)
  mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
  rgahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
  glghssdpkavmfptykyvdintfrlsaddirgiqslyg