PDB entry 4h82

View 4h82 on RCSB PDB site
Description: Crystal structure of mutant MMP-9 catalytic domain in complex with a twin inhibitor.
Class: hydrolase/hydrolase inhibitor
Keywords: HYDROLASE/TWIN INHIBITOR, Zincin-like, Gelatinase, Collagenase (Catalytic Domain), hydrolase-hydrolase inhibitor complex
Deposited on 2012-09-21, released 2013-05-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-08-12, with a file datestamp of 2015-08-07.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Matrix metalloproteinase-9
    Species: Homo sapiens [TaxId:9606]
    Gene: CLG4B, MMP9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14780 (0-105)
    • Uniprot P14780 (106-159)
      • engineered mutation (117)
    Domains in SCOPe 2.06: d4h82a_
  • Chain 'B':
    Compound: Matrix metalloproteinase-9
    Species: Homo sapiens [TaxId:9606]
    Gene: CLG4B, MMP9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14780 (0-105)
    • Uniprot P14780 (106-159)
      • engineered mutation (117)
    Domains in SCOPe 2.06: d4h82b_
  • Chain 'C':
    Compound: Matrix metalloproteinase-9
    Species: Homo sapiens [TaxId:9606]
    Gene: CLG4B, MMP9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14780 (0-105)
    • Uniprot P14780 (106-159)
      • engineered mutation (117)
    Domains in SCOPe 2.06: d4h82c_
  • Chain 'D':
    Compound: Matrix metalloproteinase-9
    Species: Homo sapiens [TaxId:9606]
    Gene: CLG4B, MMP9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14780 (0-105)
    • Uniprot P14780 (106-159)
      • engineered mutation (117)
    Domains in SCOPe 2.06: d4h82d_
  • Heterogens: ZN, CA, L29, PEG, PPI, GOL, PGO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4h82A (A:)
fegdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviq
fgvaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgqgyslflvaahqfg
halgldhssvpealmypmyrftegpplhkddvngirhlyg

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4h82B (B:)
fegdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviq
fgvaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgqgyslflvaahqfg
halgldhssvpealmypmyrftegpplhkddvngirhlyg

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4h82C (C:)
fegdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviq
fgvaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgqgyslflvaahqfg
halgldhssvpealmypmyrftegpplhkddvngirhlyg

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4h82D (D:)
fegdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviq
fgvaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgqgyslflvaahqfg
halgldhssvpealmypmyrftegpplhkddvngirhlyg