PDB entry 4h7b

View 4h7b on RCSB PDB site
Description: Crystal Structure of Staphylococcal nuclease mutant I72V/V99L
Class: hydrolase
Keywords: DNA hydrolase, RNA hydrolase, endonuclease, hydrolase
Deposited on 2012-09-20, released 2012-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered mutation (71)
      • engineered mutation (98)
    Domains in SCOPe 2.07: d4h7ba_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4h7bA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
    ftkkmvenakkvevefdkgqrtdkygrglayiyadgkmlnealvrqglakvayvykpnnt
    heqhlrkseaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h7bA (A:)
    klhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkm
    venakkvevefdkgqrtdkygrglayiyadgkmlnealvrqglakvayvykpnntheqhl
    rkseaqakkeklniws