SCOPe 2.08: Structural Classification of Proteins

PDB entry 4h6c

View 4h6c on RCSB PDB site
Description: Crystal Structure of the Allene Oxide Cyclase 1 from Physcomitrella patens
Class: isomerase
Keywords: B-barrel, Oxylipins, fatty acid, metabolites, allene-oxide cyclase activity, ISOMERASE
Deposited on 2012-09-19, released 2012-10-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-09-04, with a file datestamp of 2019-08-30.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: allene oxide cyclase
Species: Physcomitrella patens [TaxId:3218]
Gene: aoc, aoc1
Database cross-references and differences (RAF-indexed):
- Uniprot Q8GS38 (Start-194)
Domains in SCOPe 2.08: d4h6ca_
Chain 'B':
Compound: allene oxide cyclase
Species: Physcomitrella patens [TaxId:3218]
Gene: aoc, aoc1
Database cross-references and differences (RAF-indexed):
- Uniprot Q8GS38 (Start-194)
Domains in SCOPe 2.08: d4h6cb_
Chain 'C':
Compound: allene oxide cyclase
Species: Physcomitrella patens [TaxId:3218]
Gene: aoc, aoc1
Database cross-references and differences (RAF-indexed):
- Uniprot Q8GS38 (Start-194)
Domains in SCOPe 2.08: d4h6cc_
Chain 'D':
Compound: allene oxide cyclase
Species: Physcomitrella patens [TaxId:3218]
Gene: aoc, aoc1
Database cross-references and differences (RAF-indexed):
- Uniprot Q8GS38 (Start-194)
Domains in SCOPe 2.08: d4h6cd_
Chain 'E':
Compound: allene oxide cyclase
Species: Physcomitrella patens [TaxId:3218]
Gene: aoc, aoc1
Database cross-references and differences (RAF-indexed):
- Uniprot Q8GS38 (Start-194)
Domains in SCOPe 2.08: d4h6ce_
Chain 'F':
Compound: allene oxide cyclase
Species: Physcomitrella patens [TaxId:3218]
Gene: aoc, aoc1
Database cross-references and differences (RAF-indexed):
- Uniprot Q8GS38 (Start-194)
Domains in SCOPe 2.08: d4h6cf_
Chain 'G':
Compound: allene oxide cyclase
Species: Physcomitrella patens [TaxId:3218]
Gene: aoc, aoc1
Database cross-references and differences (RAF-indexed):
- Uniprot Q8GS38 (Start-194)
Domains in SCOPe 2.08: d4h6cg_
Chain 'H':
Compound: allene oxide cyclase
Species: Physcomitrella patens [TaxId:3218]
Gene: aoc, aoc1
Database cross-references and differences (RAF-indexed):
- Uniprot Q8GS38 (Start-194)
Domains in SCOPe 2.08: d4h6ch_
Chain 'I':
Compound: allene oxide cyclase
Species: Physcomitrella patens [TaxId:3218]
Gene: aoc, aoc1
Database cross-references and differences (RAF-indexed):
- Uniprot Q8GS38 (Start-194)
Domains in SCOPe 2.08: d4h6ci_
Chain 'J':
Compound: allene oxide cyclase
Species: Physcomitrella patens [TaxId:3218]
Gene: aoc, aoc1
Database cross-references and differences (RAF-indexed):
- Uniprot Q8GS38 (Start-194)
Domains in SCOPe 2.08: d4h6cj_
Chain 'K':
Compound: allene oxide cyclase
Species: Physcomitrella patens [TaxId:3218]
Gene: aoc, aoc1
Database cross-references and differences (RAF-indexed):
- Uniprot Q8GS38 (Start-194)
Domains in SCOPe 2.08: d4h6ck_
Chain 'L':
Compound: allene oxide cyclase
Species: Physcomitrella patens [TaxId:3218]
Gene: aoc, aoc1
Database cross-references and differences (RAF-indexed):
- Uniprot Q8GS38 (Start-194)
Domains in SCOPe 2.08: d4h6cl_
Heterogens: PO4, HEZ, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>4h6cA (A:)
ggplgsmaargaspghvqelfvyeinerdrgspvflpfggkkqpgtdahvnslgdlvpfs
nkiydgslktrlgitaglctlishsdqkngdryealysfyfgdyghisvqgpyityedsy
laitggsgifagcygqaklhqiifpfklfytfylqgikklpealcapcvppspsvapade
akqclpnhvapnftk