PDB entry 4h5m

View 4h5m on RCSB PDB site
Description: Crystal Structure of Rift Valley Fever Virus Nucleocapsid Protein Hexamer
Class: viral protein
Keywords: nucleocapsid protein, N protein, ribonucleoprotein, viral nucleoprotein, RNA binding, virus, RNP, VIRAL PROTEIN
Deposited on 2012-09-18, released 2012-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-12-05, with a file datestamp of 2012-11-30.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.217
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleocapsid protein
    Species: Rift Valley fever virus [TaxId:11588]
    Gene: N
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4h5ma_
  • Chain 'B':
    Compound: nucleocapsid protein
    Species: Rift Valley fever virus [TaxId:11588]
    Gene: N
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4h5mb_
  • Chain 'C':
    Compound: nucleocapsid protein
    Species: Rift Valley fever virus [TaxId:11588]
    Gene: N
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4h5mc_
  • Chain 'D':
    Compound: nucleocapsid protein
    Species: Rift Valley fever virus [TaxId:11588]
    Gene: N
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4h5md_
  • Chain 'E':
    Compound: nucleocapsid protein
    Species: Rift Valley fever virus [TaxId:11588]
    Gene: N
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4h5me_
  • Chain 'F':
    Compound: nucleocapsid protein
    Species: Rift Valley fever virus [TaxId:11588]
    Gene: N
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4h5mf_
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4h5mA (A:)
    mdnyqelaiqfaaqavdrneieqwvrefayqgfdarrviellkqyggadwekdakkmivl
    altrgnkprrmmmkmskegkatvealinkyklkegnpsrdeltlsrvaaalagrtcqalv
    vlsewlpvtgttmdglspayprhmmhpsfagmvdpslpgdylraildahslyllqfsrvi
    npnlrgrtkeevaatftqpmnaavnsnfishekrreflkafglvdsngkpsaavmaaaqa
    yktaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h5mA (A:)
    nyqelaiqfaaqavdrneieqwvrefayqgfdarrviellkqyggadwekdakkmivlal
    trgnkprrmmmkmskegkatvealinkyklkegnpsrdeltlsrvaaalagrtcqalvvl
    sewlpvtgttmdglspayprhmmhpsfagmvdpslpgdylraildahslyllqfsrvinp
    nlrgrtkeevaatftqpmnaavnsnfishekrreflkafglvdsngkpsaavmaaaqayk
    taa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4h5mB (B:)
    mdnyqelaiqfaaqavdrneieqwvrefayqgfdarrviellkqyggadwekdakkmivl
    altrgnkprrmmmkmskegkatvealinkyklkegnpsrdeltlsrvaaalagrtcqalv
    vlsewlpvtgttmdglspayprhmmhpsfagmvdpslpgdylraildahslyllqfsrvi
    npnlrgrtkeevaatftqpmnaavnsnfishekrreflkafglvdsngkpsaavmaaaqa
    yktaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h5mB (B:)
    nyqelaiqfaaqavdrneieqwvrefayqgfdarrviellkqyggadwekdakkmivlal
    trgnkprrmmmkmskegkatvealinkyklkegnpsrdeltlsrvaaalagrtcqalvvl
    sewlpvtgttmdglspayprhmmhpsfagmvdpslpgdylraildahslyllqfsrvinp
    nlrgrtkeevaatftqpmnaavnsnfishekrreflkafglvdsngkpsaavmaaaqayk
    taa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4h5mC (C:)
    mdnyqelaiqfaaqavdrneieqwvrefayqgfdarrviellkqyggadwekdakkmivl
    altrgnkprrmmmkmskegkatvealinkyklkegnpsrdeltlsrvaaalagrtcqalv
    vlsewlpvtgttmdglspayprhmmhpsfagmvdpslpgdylraildahslyllqfsrvi
    npnlrgrtkeevaatftqpmnaavnsnfishekrreflkafglvdsngkpsaavmaaaqa
    yktaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h5mC (C:)
    yqelaiqfaaqavdrneieqwvrefayqgfdarrviellkqyggadwekdakkmivlalt
    rgnkprrmmmkmskegkatvealinkyklkegnpsrdeltlsrvaaalagrtcqalvvls
    ewlpvtgttmdglspayprhmmhpsfagmvdpslpgdylraildahslyllqfsrvinpn
    lrgrtkeevaatftqpmnaavnsnfishekrreflkafglvdsngkpsaavmaaaqaykt
    aa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4h5mD (D:)
    mdnyqelaiqfaaqavdrneieqwvrefayqgfdarrviellkqyggadwekdakkmivl
    altrgnkprrmmmkmskegkatvealinkyklkegnpsrdeltlsrvaaalagrtcqalv
    vlsewlpvtgttmdglspayprhmmhpsfagmvdpslpgdylraildahslyllqfsrvi
    npnlrgrtkeevaatftqpmnaavnsnfishekrreflkafglvdsngkpsaavmaaaqa
    yktaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h5mD (D:)
    dnyqelaiqfaaqavdrneieqwvrefayqgfdarrviellkqyggadwekdakkmivla
    ltrgnkprrmmmkmskegkatvealinkyklkegnpsrdeltlsrvaaalagrtcqalvv
    lsewlpvtgttmdglspayprhmmhpsfagmvdpslpgdylraildahslyllqfsrvin
    pnlrgrtkeevaatftqpmnaavnsnfishekrreflkafglvdsngkpsaavmaaaqay
    ktaa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4h5mE (E:)
    mdnyqelaiqfaaqavdrneieqwvrefayqgfdarrviellkqyggadwekdakkmivl
    altrgnkprrmmmkmskegkatvealinkyklkegnpsrdeltlsrvaaalagrtcqalv
    vlsewlpvtgttmdglspayprhmmhpsfagmvdpslpgdylraildahslyllqfsrvi
    npnlrgrtkeevaatftqpmnaavnsnfishekrreflkafglvdsngkpsaavmaaaqa
    yktaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h5mE (E:)
    yqelaiqfaaqavdrneieqwvrefayqgfdarrviellkqyggadwekdakkmivlalt
    rgnkprrmmmkmskegkatvealinkyklkegnpsrdeltlsrvaaalagrtcqalvvls
    ewlpvtgttmdglspayprhmmhpsfagmvdpslpgdylraildahslyllqfsrvinpn
    lrgrtkeevaatftqpmnaavnsnfishekrreflkafglvdsngkpsaavmaaaqaykt
    aa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4h5mF (F:)
    mdnyqelaiqfaaqavdrneieqwvrefayqgfdarrviellkqyggadwekdakkmivl
    altrgnkprrmmmkmskegkatvealinkyklkegnpsrdeltlsrvaaalagrtcqalv
    vlsewlpvtgttmdglspayprhmmhpsfagmvdpslpgdylraildahslyllqfsrvi
    npnlrgrtkeevaatftqpmnaavnsnfishekrreflkafglvdsngkpsaavmaaaqa
    yktaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h5mF (F:)
    nyqelaiqfaaqavdrneieqwvrefayqgfdarrviellkqyggadwekdakkmivlal
    trgnkprrmmmkmskegkatvealinkyklkegnpsrdeltlsrvaaalagrtcqalvvl
    sewlpvtgttmdglspayprhmmhpsfagmvdpslpgdylraildahslyllqfsrvinp
    nlrgrtkeevaatftqpmnaavnsnfishekrreflkafglvdsngkpsaavmaaaqayk
    taa