PDB entry 4h5h

View 4h5h on RCSB PDB site
Description: Crystal structure of porcine aminopeptidase-N complexed with cleaved poly-alanine
Class: hydrolase
Keywords: zinc aminopeptidase fold, HYDROLASE
Deposited on 2012-09-18, released 2012-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-25, with a file datestamp of 2013-12-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.146
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminopeptidase N
    Species: Sus scrofa [TaxId:9823]
    Gene: ANPEP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15145 (0-900)
      • conflict (19)
      • conflict (44)
      • expression tag (901)
    Domains in SCOPe 2.07: d4h5ha1, d4h5ha2, d4h5ha3, d4h5ha4, d4h5ha5
  • Chain 'C':
    Compound: Cleaved poly-alanine
    Database cross-references and differences (RAF-indexed):
    • PDB 4H5H (0-5)
  • Heterogens: NAG, ALA, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4h5hA (A:)
    qskpwnryrlpttllpdsynvtlrpyltpnadglyifkgksivrflcqeptdviiihskk
    lnyttqghmvvlrgvgdsqvpeidrtelvelteylvvhlkgslqpghmyemesefqgela
    ddlagfyrseymegnvkkvlattqmqstdarksfpcfdepamkatfnitlihpnnltals
    nmppkgsstplaedpnwsvtefettpvmstyllayivsefqsvnetaqngvliriwarpn
    aiaeghgmyalnvtgpilnffanhyntsyplpksdqialpdfnagamenwglvtyrenal
    lfdpqsssisnkervvtviahelahqwfgnlvtlawwndlwlnegfasyveylgadhaep
    twnlkdlivpgdvyrvmavdalasshplttpaeevntpaqisemfdsisyskgasvirml
    snfltedlfkeglasylhafayqnttyldlwehlqkavdaqtsirlpdtvraimdrwtlq
    mgfpvitvdtktgnisqkhflldsesnvtrssafdylwivpissikngvmqdhywlrdvs
    qaqndlfktasddwvllnvnvtgyfqvnydednwrmiqhqlqtnlsvipvinraqviyds
    fnlatahmvpvtlaldntlflngekeympwqaalsslsyfslmfdrsevygpmkkylrkq
    veplfqhfetltknwterpenlmdqyseinaistacsnglpqcenlaktlfdqwmsdpen
    npihpnlrstiycnaiaqggqdqwdfawgqlqqaqlvneadklrsalacsnevwllnryl
    gytlnpdlirkqdatstinsiasnvigqplawdfvqsnwkklfqdygggsfsfsnliqgv
    trrfssefelqqleqfkknnmdvgfgsgtraleqalektkanikwvkenkevvlnwfieh
    sshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h5hA (A:)
    qskpwnryrlpttllpdsynvtlrpyltpnadglyifkgksivrflcqeptdviiihskk
    lnyttqghmvvlrgvgdsqvpeidrtelvelteylvvhlkgslqpghmyemesefqgela
    ddlagfyrseymegnvkkvlattqmqstdarksfpcfdepamkatfnitlihpnnltals
    nmppkgsstplaedpnwsvtefettpvmstyllayivsefqsvnetaqngvliriwarpn
    aiaeghgmyalnvtgpilnffanhyntsyplpksdqialpdfnagamenwglvtyrenal
    lfdpqsssisnkervvtviahelahqwfgnlvtlawwndlwlnegfasyveylgadhaep
    twnlkdlivpgdvyrvmavdalasshplttpaeevntpaqisemfdsisyskgasvirml
    snfltedlfkeglasylhafayqnttyldlwehlqkavdaqtsirlpdtvraimdrwtlq
    mgfpvitvdtktgnisqkhflldsesnvtrssafdylwivpissikngvmqdhywlrdvs
    qaqndlfktasddwvllnvnvtgyfqvnydednwrmiqhqlqtnlsvipvinraqviyds
    fnlatahmvpvtlaldntlflngekeympwqaalsslsyfslmfdrsevygpmkkylrkq
    veplfqhfetltknwterpenlmdqyseinaistacsnglpqcenlaktlfdqwmsdpen
    npihpnlrstiycnaiaqggqdqwdfawgqlqqaqlvneadklrsalacsnevwllnryl
    gytlnpdlirkqdatstinsiasnvigqplawdfvqsnwkklfqdygggsfsfsnliqgv
    trrfssefelqqleqfkknnmdvgfgsgtraleqalektkanikwvkenkevvlnwfieh
    ss
    

  • Chain 'C':
    No sequence available.