PDB entry 4h58

View 4h58 on RCSB PDB site
Description: BRAF in complex with compound 3
Class: transferase/transferase inhibitor
Keywords: protein kinase, structure based drug discovery, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-09-18, released 2013-02-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.224
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase B-raf
    Species: Homo sapiens [TaxId:9606]
    Gene: BRAF, BRAF1, RAFB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4h58a_
  • Chain 'B':
    Compound: Serine/threonine-protein kinase B-raf
    Species: Homo sapiens [TaxId:9606]
    Gene: BRAF, BRAF1, RAFB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4h58b_
  • Chain 'C':
    Compound: Serine/threonine-protein kinase B-raf
    Species: Homo sapiens [TaxId:9606]
    Gene: BRAF, BRAF1, RAFB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4h58c_
  • Heterogens: 10Z, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4h58A (A:)
    ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
    trhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
    haksiihrdlksnniflhedltvkigdfglatvksrwsgshqfeqlsgsilwmapevirm
    qdknpysfqsdvyafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpk
    amkrlmaeclkkkrderplfpqilasiellarslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h58A (A:)
    ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
    trhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
    haksiihrdlksnniflhedltvkigdfglatvksgsilwmapevirmqdknpysfqsdv
    yafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpkamkrlmaeclkk
    krderplfpqilasiellarslp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4h58B (B:)
    ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
    trhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
    haksiihrdlksnniflhedltvkigdfglatvksrwsgshqfeqlsgsilwmapevirm
    qdknpysfqsdvyafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpk
    amkrlmaeclkkkrderplfpqilasiellarslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h58B (B:)
    ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
    trhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
    haksiihrdlksnniflhedltvkigdfglatlsgsilwmapevirmqdknpysfqsdvy
    afgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpkamkrlmaeclkkk
    rderplfpqilasiellarslp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4h58C (C:)
    ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
    trhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
    haksiihrdlksnniflhedltvkigdfglatvksrwsgshqfeqlsgsilwmapevirm
    qdknpysfqsdvyafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpk
    amkrlmaeclkkkrderplfpqilasiellarslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h58C (C:)
    dweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrkt
    rhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdylh
    aksiihrdlksnniflhedltvkigdfglatvksrwsgshqfeqlsgsilwmapevirmq
    npysfqsdvyafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpkamk
    rlmaeclkkkrderplfpqilasiellarslp