PDB entry 4h51

View 4h51 on RCSB PDB site
Description: Crystal structure of a putative Aspartate Aminotransferase from Leishmania major Friedlin
Class: transferase
Keywords: SSGCID, Leishmania major, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, Aspartate aminotransferase, TRANSFERASE, pyridoxal phosphate
Deposited on 2012-09-18, released 2012-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-05-20, with a file datestamp of 2015-05-15.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate aminotransferase
    Species: Leishmania major [TaxId:347515]
    Gene: asat, LMJF_24_0370, LMJF_35_0820
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4h51a_
  • Chain 'B':
    Compound: aspartate aminotransferase
    Species: Leishmania major [TaxId:347515]
    Gene: asat, LMJF_24_0370, LMJF_35_0820
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4h51b_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4h51A (A:)
    mahhhhhhmstqaamttaerwqkiqaqapdvifdlakraaaakgpkanlvigayrdeqgr
    pyplrvvrkaeqllldmnldyeylpisgyqpfideavkiiygntvelenlvavqtlsgtg
    avslgaklltrvfdaettpiylsdptwpnhygvvkaagwknictyayydpktvslnfegm
    kkdilaapdgsvfilhqcahnptgvdpsqeqwneiaslmlakhhqvffdsayqgyasgsl
    dtdayaarlfarrgievllaqsfsknmglyseragtlslllkdktkradvksvmdslire
    eytcppahgarlahlilsnnelrkeweaelsamaerirtmrrtvydellrlqtpgswehv
    inqigmfsflglskaqceycqnhnifitvsgranmaglthetalmlaqtindavrnvnre
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h51A (A:)
    mttaerwqkiqaqapdvifdlakraaaakgpkanlvigayrdeqgrpyplrvvrkaeqll
    ldmnldyeylpisgyqpfideavkiiygelenlvavqtlsgtgavslgaklltrvfdaet
    tpiylsdptwpnhygvvkaagwknictyayydpktvslnfegmkkdilaapdgsvfilhq
    cahnptgvdpsqeqwneiaslmlakhhqvffdsayqgyasgsldtdayaarlfarrgiev
    llaqsfsknmglyseragtlslllkdktkradvksvmdslireeytcppahgarlahlil
    snnelrkeweaelsamaerirtmrrtvydellrlqtpgswehvinqigmfsflglskaqc
    eycqnhnifitvsgranmaglthetalmlaqtindavr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4h51B (B:)
    mahhhhhhmstqaamttaerwqkiqaqapdvifdlakraaaakgpkanlvigayrdeqgr
    pyplrvvrkaeqllldmnldyeylpisgyqpfideavkiiygntvelenlvavqtlsgtg
    avslgaklltrvfdaettpiylsdptwpnhygvvkaagwknictyayydpktvslnfegm
    kkdilaapdgsvfilhqcahnptgvdpsqeqwneiaslmlakhhqvffdsayqgyasgsl
    dtdayaarlfarrgievllaqsfsknmglyseragtlslllkdktkradvksvmdslire
    eytcppahgarlahlilsnnelrkeweaelsamaerirtmrrtvydellrlqtpgswehv
    inqigmfsflglskaqceycqnhnifitvsgranmaglthetalmlaqtindavrnvnre
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h51B (B:)
    mttaerwqkiqaqapdvifdlakraaaakgpkanlvigayrdeqgrpyplrvvrkaeqll
    ldmnldyeylpisgyqpfideavkiiygntvelenlvavqtlsgtgavslgaklltrvfd
    aettpiylsdptwpnhygvvkaagwknictyayydpktvslnfegmkkdilaapdgsvfi
    lhqcahnptgvdpsqeqwneiaslmlakhhqvffdsayqgyasgsldtdayaarlfarrg
    ievllaqsfsknmglyseragtlslllkdktkradvksvmdslireeytcppahgarlah
    lilsnnelrkeweaelsamaerirtmrrtvydellrlqtpgswehvinqigmfsflglsk
    aqceycqnhnifitvsgranmaglthetalmlaqtindavrnv