PDB entry 4h4f

View 4h4f on RCSB PDB site
Description: Crystal structure of human chymotrypsin C (CTRC) bound to inhibitor eglin c from Hirudo medicinalis
Class: hydrolase/hydrolase inhibitor
Keywords: Serine protease, protease inhibitor, hydrolase-hydrolase inhibitor complex
Deposited on 2012-09-17, released 2013-02-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-04-24, with a file datestamp of 2013-04-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.16
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Chymotrypsin-C
  Species: Homo sapiens [TaxId:9606]
  Gene: CLCR, CTRC
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q99895 (0-238)
• Chain 'B':
  Compound: eglin c
  Species: Hirudo medicinalis [TaxId:6421]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01051 (7-69)
  Domains in SCOPe 2.04: d4h4fb_
• Chain 'Q':
  Compound: Chymotrypsin-C
  Species: Homo sapiens [TaxId:9606]
  Gene: CLCR, CTRC
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q99895 (0-9)
• Heterogens: PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >4h4fB (B:)
  msmgselksfpevvgktvdqareyftlhypqydvyflpegspvtldlrynrvrvfynpgt
  nvvnhvphvg
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4h4fB (B:)
  ksfpevvgktvdqareyftlhypqydvyflpegspvtldlrynrvrvfynpgtnvvnhvp
  hvg
  

  
  
• Chain 'Q':
  No sequence available.