PDB entry 4h3x

View 4h3x on RCSB PDB site
Description: Crystal structure of an MMP broad spectrum hydroxamate based inhibitor CC27 in complex with the MMP-9 catalytic domain
Class: HYDROLASE/HYDROLASE Inhibitor
Keywords: HYDROLASE/HYDROXAMATE INHIBITOR, Zincin-like, Gelatinase, Collagenase (Catalytic Domain), HYDROLASE-HYDROLASE Inhibitor complex
Deposited on 2012-09-14, released 2013-04-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-08-12, with a file datestamp of 2015-08-07.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human MMP-9 catalytic domain wild-type
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP9, CLG4B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14780 (0-108)
      • expression tag (109)
    • Uniprot P14780 (93-163)
      • engineered mutation (121)
    Domains in SCOPe 2.06: d4h3xa_
  • Chain 'B':
    Compound: human MMP-9 catalytic domain wild-type
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP9, CLG4B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14780 (0-108)
      • expression tag (109)
    • Uniprot P14780 (93-163)
      • engineered mutation (121)
    Domains in SCOPe 2.06: d4h3xb_
  • Heterogens: ZN, CA, 10B, GOL, PGO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4h3xA (A:)
gfqtfegdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdad
iviqfgvaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgvgyslflvaa
hefghalgldhssvpealmypmyrftegpplhkddvngirhlyg

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4h3xB (B:)
gfqtfegdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdad
iviqfgvaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgvgyslflvaa
hefghalgldhssvpealmypmyrftegpplhkddvngirhlyg