PDB entry 4h32

View 4h32 on RCSB PDB site
Description: The crystal structure of the hemagglutinin H17 derived the bat influenza A virus
Class: viral protein
Keywords: homotrimer, virus entry and fusion, envelope of virus, VIRAL PROTEIN
Deposited on 2012-09-13, released 2013-07-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.219
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1129347]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot H6QM93 (1-319)
      • expression tag (0)
    Domains in SCOPe 2.05: d4h32a_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1129347]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot H6QM93 (Start-170)
      • conflict (170)
    Domains in SCOPe 2.05: d4h32b_
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1129347]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot H6QM93 (1-319)
      • expression tag (0)
    Domains in SCOPe 2.05: d4h32c_
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1129347]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot H6QM93 (0-170)
      • conflict (170)
    Domains in SCOPe 2.05: d4h32d_
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1129347]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot H6QM93 (1-319)
      • expression tag (0)
    Domains in SCOPe 2.05: d4h32e_
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1129347]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot H6QM93 (0-170)
      • conflict (170)
    Domains in SCOPe 2.05: d4h32f_
  • Chain 'G':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1129347]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot H6QM93 (1-319)
      • expression tag (0)
    Domains in SCOPe 2.05: d4h32g_
  • Chain 'H':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1129347]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot H6QM93 (0-170)
      • conflict (170)
    Domains in SCOPe 2.05: d4h32h_
  • Chain 'I':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1129347]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot H6QM93 (1-319)
      • expression tag (0)
    Domains in SCOPe 2.05: d4h32i_
  • Chain 'J':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1129347]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot H6QM93 (0-170)
      • conflict (170)
    Domains in SCOPe 2.05: d4h32j_
  • Chain 'K':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1129347]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot H6QM93 (1-319)
      • expression tag (0)
    Domains in SCOPe 2.05: d4h32k_
  • Chain 'L':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1129347]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot H6QM93 (0-170)
      • conflict (170)
    Domains in SCOPe 2.05: d4h32l_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h32A (A:)
    qdricigyqanqnnqtvntlleqnvpvtgaqeiletnhngklcslngvppldlqsctlag
    wllgnpncdnlleaeewsyikinenapddlcfpgnfenlqdlllemsgvqnftkvklfnp
    qsmtgvttnnvdqtcpfegkpsfyrnlnwiqgnsglpfnieiknptsnpllllwgihntk
    daaqqrnlygndysytifnfgekseefrpdigqrdeikahqdridyywgslpaqstlrie
    stgnliapeygfyykrkegkgglmksklpisdcstkcqtplgalnstlpfqnvhqqtign
    cpkyvkatslmlatglrnnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4h32B (B:)
    agfieggwqgmidgwygyhhenqegsgyaadkeatqkavdaitnkvnsiidkmnsqfesn
    ikefnrlelriqhlsdrvddalldiwsyntellvllenertldfhdanvknlfekvkaql
    kdnaidegngcflllhkcnnscmddikngtykymdyreeshiekqkidgve
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h32B (B:)
    ieggwqgmidgwygyhhenqegsgyaadkeatqkavdaitnkvnsiidkmnsqfesnike
    fnrlelriqhlsdrvddalldiwsyntellvllenertldfhdanvknlfekvkaqlkdn
    aidegngcflllhkcnnscmddikngtykymdyreeshiekqkidgve
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h32C (C:)
    qdricigyqanqnnqtvntlleqnvpvtgaqeiletnhngklcslngvppldlqsctlag
    wllgnpncdnlleaeewsyikinenapddlcfpgnfenlqdlllemsgvqnftkvklfnp
    qsmtgvttnnvdqtcpfegkpsfyrnlnwiqgnsglpfnieiknptsnpllllwgihntk
    daaqqrnlygndysytifnfgekseefrpdigqrdeikahqdridyywgslpaqstlrie
    stgnliapeygfyykrkegkgglmksklpisdcstkcqtplgalnstlpfqnvhqqtign
    cpkyvkatslmlatglrnnp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h32D (D:)
    agfieggwqgmidgwygyhhenqegsgyaadkeatqkavdaitnkvnsiidkmnsqfesn
    ikefnrlelriqhlsdrvddalldiwsyntellvllenertldfhdanvknlfekvkaql
    kdnaidegngcflllhkcnnscmddikngtykymdyreeshiekqkidgve
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h32E (E:)
    qdricigyqanqnnqtvntlleqnvpvtgaqeiletnhngklcslngvppldlqsctlag
    wllgnpncdnlleaeewsyikinenapddlcfpgnfenlqdlllemsgvqnftkvklfnp
    qsmtgvttnnvdqtcpfegkpsfyrnlnwiqgnsglpfnieiknptsnpllllwgihntk
    daaqqrnlygndysytifnfgekseefrpdigqrdeikahqdridyywgslpaqstlrie
    stgnliapeygfyykrkegkgglmksklpisdcstkcqtplgalnstlpfqnvhqqtign
    cpkyvkatslmlatglrnnp
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h32F (F:)
    agfieggwqgmidgwygyhhenqegsgyaadkeatqkavdaitnkvnsiidkmnsqfesn
    ikefnrlelriqhlsdrvddalldiwsyntellvllenertldfhdanvknlfekvkaql
    kdnaidegngcflllhkcnnscmddikngtykymdyreeshiekqkidgve
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h32G (G:)
    qdricigyqanqnnqtvntlleqnvpvtgaqeiletnhngklcslngvppldlqsctlag
    wllgnpncdnlleaeewsyikinenapddlcfpgnfenlqdlllemsgvqnftkvklfnp
    qsmtgvttnnvdqtcpfegkpsfyrnlnwiqgnsglpfnieiknptsnpllllwgihntk
    daaqqrnlygndysytifnfgekseefrpdigqrdeikahqdridyywgslpaqstlrie
    stgnliapeygfyykrkegkgglmksklpisdcstkcqtplgalnstlpfqnvhqqtign
    cpkyvkatslmlatglrnnp
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h32H (H:)
    agfieggwqgmidgwygyhhenqegsgyaadkeatqkavdaitnkvnsiidkmnsqfesn
    ikefnrlelriqhlsdrvddalldiwsyntellvllenertldfhdanvknlfekvkaql
    kdnaidegngcflllhkcnnscmddikngtykymdyreeshiekqkidgve
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h32I (I:)
    qdricigyqanqnnqtvntlleqnvpvtgaqeiletnhngklcslngvppldlqsctlag
    wllgnpncdnlleaeewsyikinenapddlcfpgnfenlqdlllemsgvqnftkvklfnp
    qsmtgvttnnvdqtcpfegkpsfyrnlnwiqgnsglpfnieiknptsnpllllwgihntk
    daaqqrnlygndysytifnfgekseefrpdigqrdeikahqdridyywgslpaqstlrie
    stgnliapeygfyykrkegkgglmksklpisdcstkcqtplgalnstlpfqnvhqqtign
    cpkyvkatslmlatglrnnp
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h32J (J:)
    agfieggwqgmidgwygyhhenqegsgyaadkeatqkavdaitnkvnsiidkmnsqfesn
    ikefnrlelriqhlsdrvddalldiwsyntellvllenertldfhdanvknlfekvkaql
    kdnaidegngcflllhkcnnscmddikngtykymdyreeshiekqkidgve
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h32K (K:)
    qdricigyqanqnnqtvntlleqnvpvtgaqeiletnhngklcslngvppldlqsctlag
    wllgnpncdnlleaeewsyikinenapddlcfpgnfenlqdlllemsgvqnftkvklfnp
    qsmtgvttnnvdqtcpfegkpsfyrnlnwiqgnsglpfnieiknptsnpllllwgihntk
    daaqqrnlygndysytifnfgekseefrpdigqrdeikahqdridyywgslpaqstlrie
    stgnliapeygfyykrkegkgglmksklpisdcstkcqtplgalnstlpfqnvhqqtign
    cpkyvkatslmlatglrnnp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h32L (L:)
    agfieggwqgmidgwygyhhenqegsgyaadkeatqkavdaitnkvnsiidkmnsqfesn
    ikefnrlelriqhlsdrvddalldiwsyntellvllenertldfhdanvknlfekvkaql
    kdnaidegngcflllhkcnnscmddikngtykymdyreeshiekqkidgve