PDB entry 4h2z

View 4h2z on RCSB PDB site
Description: Crystal structure of human GLTP bound with 12:0 monosulfatide
Class: lipid transport
Keywords: GlTP-fold, lipid transport
Deposited on 2012-09-13, released 2013-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-10, with a file datestamp of 2013-04-05.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.162
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycolipid transfer protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GLTP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4h2za_
  • Heterogens: EIS, MYS, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4h2zA (A:)
    mallaehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavy
    dtnpakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenh
    pnlirvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeecleki
    rlflvnytatidviyemytqmnaelnykv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h2zA (A:)
    hllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtnpak
    frtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnlirv
    natkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekirlflvn
    ytatidviyemytqmnaelnykv