PDB entry 4h2y
View 4h2y on RCSB PDB site
Description: Crystal structure of engineered Bradyrhizobium japonicum glycine:[carrier protein] ligase complexed with carrier protein from Agrobacterium tumefaciens and ATP
Class: ligase
Keywords: Ligase, ATP binding, glycine binding, carrier protein, aminoacyl-tRNA synthetase, seryl-tRNA synthetase
Deposited on
2012-09-13, released
2013-03-06
The last revision prior to the SCOPe 2.05 freeze date was dated
2013-05-29, with a file datestamp of
2013-05-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.178
AEROSPACI score: 0.45
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Amino acid--[acyl-carrier-protein] ligase 1
Species: Bradyrhizobium japonicum [TaxId:224911]
Gene: bll0957
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Amino acid--[acyl-carrier-protein] ligase 1
Species: Bradyrhizobium japonicum [TaxId:224911]
Gene: bll0957
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: Aminoacyl carrier protein
Species: Agrobacterium tumefaciens [TaxId:176299]
Gene: AGR_C_4658, Atu2571
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d4h2yc_ - Chain 'D':
Compound: Aminoacyl carrier protein
Species: Agrobacterium tumefaciens [TaxId:176299]
Gene: AGR_C_4658, Atu2571
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d4h2yd_ - Heterogens: ZN, ATP, MG, PNS, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
Sequence, based on SEQRES records: (download)
>4h2yC (C:)
mgsshhhhhhssglvprgshmnatireilakfgqlptpvdtiadeadlyaaglssfasvq
lmlgieeafdiefpdnllnrksfasikaiedtvklildgkeaa
Sequence, based on observed residues (ATOM records): (download)
>4h2yC (C:)
hmnatireilakfgqlptpvdtiadeadlyaaglssfasvqlmlgieeafdiefpdnlln
rksfasikaiedtvkli
- Chain 'D':
Sequence, based on SEQRES records: (download)
>4h2yD (D:)
mgsshhhhhhssglvprgshmnatireilakfgqlptpvdtiadeadlyaaglssfasvq
lmlgieeafdiefpdnllnrksfasikaiedtvklildgkeaa
Sequence, based on observed residues (ATOM records): (download)
>4h2yD (D:)
natireilakfgqlplyaaglssfasvqlmlgieeafdiefpdnllnrksfasikaiedt
vkl