PDB entry 4h2w

View 4h2w on RCSB PDB site
Description: Crystal structure of engineered Bradyrhizobium japonicum glycine:[carrier protein] ligase complexed with carrier protein from Agrobacterium tumefaciens and AMP
Class: ligase
Keywords: Ligase, ATP binding, glycine binding, carrier protein, aminoacyl-tRNA synthetase, seryl-tRNA synthetase
Deposited on 2012-09-13, released 2013-03-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-05-29, with a file datestamp of 2013-05-24.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.173
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amino acid--[acyl-carrier-protein] ligase 1
    Species: Bradyrhizobium japonicum [TaxId:224911]
    Gene: bll0957
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Amino acid--[acyl-carrier-protein] ligase 1
    Species: Bradyrhizobium japonicum [TaxId:224911]
    Gene: bll0957
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Aminoacyl carrier protein
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: AGR_C_4658, Atu2571
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9CHM9 (20-End)
      • expression tag (19)
    Domains in SCOPe 2.04: d4h2wc_
  • Chain 'D':
    Compound: Aminoacyl carrier protein
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: AGR_C_4658, Atu2571
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4h2wd_
  • Heterogens: ZN, CL, 5GP, AMP, PNS, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4h2wC (C:)
    mgsshhhhhhssglvprgshmnatireilakfgqlptpvdtiadeadlyaaglssfasvq
    lmlgieeafdiefpdnllnrksfasikaiedtvklildgkeaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h2wC (C:)
    hmnatireilakfgqlptpvdtiadeadlyaaglssfasvqlmlgieeafdiefpdnlln
    rksfasikaiedtvklil
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4h2wD (D:)
    mgsshhhhhhssglvprgshmnatireilakfgqlptpvdtiadeadlyaaglssfasvq
    lmlgieeafdiefpdnllnrksfasikaiedtvklildgkeaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h2wD (D:)
    mnatireilakfgqlptpvdtiadeadlyaaglssfasvqlmlgieeafdiefpdnllnr
    ksfasikaiedtvkl