PDB entry 4h2o

View 4h2o on RCSB PDB site
Description: Structure of E. coli undecaprenyl diphosphate synthase in complex with BPH-1248
Class: transferase/transferase inhibitor
Keywords: prenyl transferase inhibitor complex, alpha-helix, prenyl transferase, cell wall biosynthesis, farnesyl diphosphate binding, isopentenyl diphosphate binding, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-09-13, released 2012-12-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: 0.235
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: undecaprenyl pyrophosphate synthase
    Species: Escherichia coli [TaxId:562]
    Gene: uppS, ispU, rth, yaeS, b0174, JW0169
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4h2oa_
  • Chain 'B':
    Compound: undecaprenyl pyrophosphate synthase
    Species: Escherichia coli [TaxId:562]
    Gene: uppS, ispU, rth, yaeS, b0174, JW0169
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4h2ob_
  • Heterogens: 0YW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4h2oA (A:)
    mmlsatqplseklpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaann
    giealtlyafssenwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrl
    qerirksealtagntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqh
    vcmhelapvdlvirtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre
    rrfggtepgdeta
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h2oA (A:)
    gcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafsalmel
    fvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltlniaanyggr
    wdivqgvrqlaeklqpdqideemlnqhvcmhelapvdlvirtggehrisnfllwqiayae
    lyftdvlwpdfdeqdfegalnafanr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4h2oB (B:)
    mmlsatqplseklpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaann
    giealtlyafssenwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrl
    qerirksealtagntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqh
    vcmhelapvdlvirtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre
    rrfggtepgdeta
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h2oB (B:)
    pahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafssf
    vwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltlniaanyggrw
    divqgvrqlaekvqqgqpdqideemlnqhvcmhelapvdlvirtggehrisnfllwqiay
    aelyftdvlwpdfdeqdfegalnafanr