PDB entry 4h2l

View 4h2l on RCSB PDB site
Description: Deer mouse hemoglobin in hydrated format
Class: oxygen transport
Keywords: Hemoglobin, Oxygen transport
Deposited on 2012-09-12, released 2013-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.165
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-globin
    Species: Peromyscus maniculatus [TaxId:10042]
    Gene: HBA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4h2la_
  • Chain 'B':
    Compound: Beta globin
    Species: Peromyscus maniculatus [TaxId:10042]
    Gene: HBB-T1, HBB-T2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4h2lb_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h2lA (A:)
    vlsaddkanikaawgkigghgaeygaealermfcsfpttktyfphfdvshgsaqvkahgg
    kvadalataaghlddlpaalsalsdlhahklrvdpvnfkllshcllvtlaahlpsdftpa
    vhasldkflasvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h2lB (B:)
    vhltdaekalvtglwgkvkpeeiggealgrllavypwtqrffdsfgdlssasaimgnakv
    kahgkkvidsfseglkhldnlkgtfaslselhcdklhvdpenfkllgnmivivmahhlgk
    dftpaaqsayqkvvsgvatalahkyh