PDB entry 4h2e

View 4h2e on RCSB PDB site
Description: Crystal structure of an MMP twin inhibitor complexing two MMP-9 catalytic domains
Class: hydrolase/hydrolase inhibitor
Keywords: HYDROLASE/TWIN INHIBITOR, Zincin-like, Gelatinase, Collagenase (Catalytic Domain), HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-09-12, released 2013-04-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-08-12, with a file datestamp of 2015-08-07.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: human MMP-9 catalytic domain wild-type
  Species: Homo sapiens [TaxId:9606]
  Gene: MMP9, CLG4B
  Database cross-references and differences (RAF-indexed):
  • Uniprot P14780 (1-108)
    • expression tag (0)
  • Uniprot P14780 (93-163)
    • engineered mutation (121)
  Domains in SCOPe 2.06: d4h2ea1, d4h2ea2
• Chain 'B':
  Compound: human MMP-9 catalytic domain wild-type
  Species: Homo sapiens [TaxId:9606]
  Gene: MMP9, CLG4B
  Database cross-references and differences (RAF-indexed):
  • Uniprot P14780 (1-108)
    • expression tag (0)
  • Uniprot P14780 (93-163)
    • engineered mutation (121)
  Domains in SCOPe 2.06: d4h2eb1, d4h2eb2
• Heterogens: ZN, CA, PEG, ACT, BCN, 0Y3, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4h2eA (A:)
  gfqtfegdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdad
  iviqfgvaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgvgyslflvaa
  hefghalgldhssvpealmypmyrftegpplhkddvngirhlyg
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4h2eB (B:)
  gfqtfegdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdad
  iviqfgvaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgvgyslflvaa
  hefghalgldhssvpealmypmyrftegpplhkddvngirhlyg