PDB entry 4h2e
View 4h2e on RCSB PDB site
Description: Crystal structure of an MMP twin inhibitor complexing two MMP-9 catalytic domains
Class: hydrolase/hydrolase inhibitor
Keywords: HYDROLASE/TWIN INHIBITOR, Zincin-like, Gelatinase, Collagenase (Catalytic Domain), HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on
2012-09-12, released
2013-04-24
The last revision prior to the SCOPe 2.03 freeze date was dated
2013-05-01, with a file datestamp of
2013-04-26.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.279
AEROSPACI score: 0.16
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: human MMP-9 catalytic domain wild-type
Species: Homo sapiens [TaxId:9606]
Gene: MMP9, CLG4B
Database cross-references and differences (RAF-indexed):
- Uniprot P14780 (1-108)
- Uniprot P14780 (93-163)
- engineered mutation (121)
Domains in SCOPe 2.03: d4h2ea_ - Chain 'B':
Compound: human MMP-9 catalytic domain wild-type
Species: Homo sapiens [TaxId:9606]
Gene: MMP9, CLG4B
Database cross-references and differences (RAF-indexed):
- Uniprot P14780 (1-108)
- Uniprot P14780 (93-163)
- engineered mutation (121)
Domains in SCOPe 2.03: d4h2eb_ - Heterogens: ZN, CA, PEG, ACT, BCN, 0Y3, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>4h2eA (A:)
gfqtfegdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdad
iviqfgvaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgvgyslflvaa
hefghalgldhssvpealmypmyrftegpplhkddvngirhlyg
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>4h2eB (B:)
gfqtfegdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdad
iviqfgvaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgvgyslflvaa
hefghalgldhssvpealmypmyrftegpplhkddvngirhlyg