PDB entry 4h26

View 4h26 on RCSB PDB site
Description: TCR interaction with peptide mimics of nickel offers structure insight to nickel contact allergy
Class: immune system
Keywords: protein-protein complex, immunoglobulin fold, antigen presentation, TCR, cell surface, IMMUNE SYSTEM
Deposited on 2012-09-12, released 2013-10-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-16, with a file datestamp of 2013-10-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.225
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hla class II histocompatibility antigen, dr alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DRA, HLA-DRA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4h26a1, d4h26a2
  • Chain 'B':
    Compound: MHC class II antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DRB3
    Database cross-references and differences (RAF-indexed):
    • Uniprot B8YAC7 (3-185)
      • expression tag (0-2)
      • conflict (74)
      • expression tag (186-187)
    Domains in SCOPe 2.07: d4h26b1, d4h26b2, d4h26b3, d4h26b4
  • Chain 'C':
    Compound: peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 4H26 (0-10)
  • Chain 'D':
    Compound: hla class II histocompatibility antigen, dr alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DRA, HLA-DRA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4h26d1, d4h26d2
  • Chain 'E':
    Compound: MHC class II antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DRB3
    Database cross-references and differences (RAF-indexed):
    • Uniprot B8YAC7 (3-185)
      • expression tag (0-2)
      • conflict (74)
      • expression tag (186-187)
    Domains in SCOPe 2.07: d4h26e1, d4h26e2, d4h26e3, d4h26e4
  • Chain 'F':
    Compound: peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 4H26 (0-10)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h26A (A:)
    eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
    iavdkanleimtkrsnytpitnvppevtvltnspvelrepnvlicfidkftppvvnvtwl
    rngkpvttgvsetvflpredhlfrkfhylpflpstedvydcrvehwgldepllkhwefd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h26B (B:)
    trprflellksechffngtervrfleryfhnqeefvrfdsdvgeyravtelgrpvaeswn
    sqkdlleqkrgqvdtycrhnygvvesftvqrrvhpqvtvypaktqplqhhnllvcsvsgf
    ypgsievrwfrngqeektgvvstglihngdwtfqtlvmletvprsgevytcqvehpsvts
    pltvewra
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h26D (D:)
    eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
    iavdkanleimtkrsnytpitnvppevtvltnspvelrepnvlicfidkftppvvnvtwl
    rngkpvttgvsetvflpredhlfrkfhylpflpstedvydcrvehwgldepllkhwefd
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h26E (E:)
    trprflellksechffngtervrfleryfhnqeefvrfdsdvgeyravtelgrpvaeswn
    sqkdlleqkrgqvdtycrhnygvvesftvqrrvhpqvtvypaktqplqhhnllvcsvsgf
    ypgsievrwfrngqeektgvvstglihngdwtfqtlvmletvprsgevytcqvehpsvts
    pltvewra
    

  • Chain 'F':
    No sequence available.