PDB entry 4h25

View 4h25 on RCSB PDB site
Description: TCR interaction with peptide mimics of nickel offers structure insights to nickel contact allergy
Class: immune system
Keywords: protein protein complex, immunoglobulin fold, antigen presentation, TCR, cell surface, IMMUNE SYSTEM
Deposited on 2012-09-12, released 2013-10-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-16, with a file datestamp of 2013-10-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.21
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hla class II histocompatibility antigen, dr alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DRA, HLA-DRA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4h25a1, d4h25a2
  • Chain 'B':
    Compound: MHC class II antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DRB3
    Database cross-references and differences (RAF-indexed):
    • Uniprot B8YAC7 (3-185)
      • expression tag (0-2)
      • conflict (74)
      • expression tag (186-187)
    Domains in SCOPe 2.07: d4h25b1, d4h25b2, d4h25b3, d4h25b4
  • Chain 'C':
    Compound: peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 4H25 (0-21)
  • Chain 'D':
    Compound: hla class II histocompatibility antigen, dr alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DRA, HLA-DRA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4h25d1, d4h25d2
  • Chain 'E':
    Compound: MHC class II antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DRB3
    Database cross-references and differences (RAF-indexed):
    • Uniprot B8YAC7 (3-185)
      • expression tag (0-2)
      • conflict (74)
      • expression tag (186-187)
    Domains in SCOPe 2.07: d4h25e1, d4h25e2, d4h25e3, d4h25e4
  • Chain 'F':
    Compound: peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 4H25 (0-21)
  • Heterogens: IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h25A (A:)
    eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
    iavdkanleimtkrsnytpitnvppevtvltnspvelrepnvlicfidkftppvvnvtwl
    rngkpvttgvsetvflpredhlfrkfhylpflpstedvydcrvehwgldepllkhwefda
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h25B (B:)
    trprflellksechffngtervrfleryfhnqeefvrfdsdvgeyravtelgrpvaeswn
    sqkdlleqkrgqvdtycrhnygvvesftvqrrvhpqvtvypaktqplqhhnllvcsvsgf
    ypgsievrwfrngqeektgvvstglihngdwtfqtlvmletvprsgevytcqvehpsvts
    pltvewra
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h25D (D:)
    eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
    iavdkanleimtkrsnytpitnvppevtvltnspvelrepnvlicfidkftppvvnvtwl
    rngkpvttgvsetvflpredhlfrkfhylpflpstedvydcrvehwgldepllkhwefda
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4h25E (E:)
    trprflellksechffngtervrfleryfhnqeefvrfdsdvgeyravtelgrpvaeswn
    sqkdlleqkrgqvdtycrhnygvvesftvqrrvhpqvtvypaktqplqhhnllvcsvsgf
    ypgsievrwfrngqeektgvvstglihngdwtfqtlvmletvprsgevytcqvehpsvts
    pltvewra
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h25E (E:)
    trprflellksechffngtervrfleryfhnqeefvrfdsdvgeyravtelgrpvaeswn
    sqkdlleqkrgqvdtycrhnygvvesftvqrrvhpqvtvypaktnllvcsvsgfypgsie
    vrwfrngqeektgvvstglihngdwtfqtlvmletvprsgevytcqvehpsvtspltvew
    ra
    

  • Chain 'F':
    No sequence available.