PDB entry 4h1m

View 4h1m on RCSB PDB site
Description: Crystal structure of PYK2 with the indole 10c
Class: transferase/transferase inhibitor
Keywords: kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-09-10, released 2012-11-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-12-12, with a file datestamp of 2012-12-07.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.226
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein-tyrosine kinase 2-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: PTK2B, FAK2, PYK2, RAFTK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4h1ma_
  • Heterogens: 0YJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4h1mA (A:)
    mhhhhhhssglvprgspqygiaredvvlnrilgegffgevyegvytnhkgekinvavktc
    kkdctldnkekfmseavimknldhphivkligiieeeptwiimelypygelghylernkn
    slkvltlvlyslqickamaylesincvhrdiavrnilvaspecvklgdfglsryiededy
    ykasvtrlpikwmspesinfrrfttasdvwmfavcmweilsfgkqpffwlenkdvigvle
    kgdrlpkpdlcppvlytlmtrcwdydpsdrprftelvcslsdvyqmekdiame
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h1mA (A:)
    iaredvvlnrilgegffgevyegvytnhkgekinvavktckkdctldnkekfmseavimk
    nldhphivkligiieeeptwiimelypygelghylernknslkvltlvlyslqickamay
    lesincvhrdiavrnilvaspecvklgdfglslpikwmspesinfrrfttasdvwmfavc
    mweilsfgkqpffwlenkdvigvlekgdrlpkpdlcppvlytlmtrcwdydpsdrprfte
    lvcslsdvyqmekdia