PDB entry 4h13

View 4h13 on RCSB PDB site
Description: Crystal Structure of the Cytochrome b6f Complex from Mastigocladus laminosus with TDS
Class: photosynthesis
Keywords: Alpha helix, beta sheet, Plastoquinol-plastocyanin oxidoreductase, Plastocyanin, Thylakoid membrane, PHOTOSYNTHESIS
Deposited on 2012-09-10, released 2013-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-03, with a file datestamp of 2013-03-29.
Experiment type: XRAY
Resolution: 3.07 Å
R-factor: 0.215
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome b6
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4h13a_
  • Chain 'B':
    Compound: Cytochrome b6-f complex subunit 4
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4h13b_
  • Chain 'C':
    Compound: Apocytochrome f
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83793 (0-End)
      • see remark 999 (10)
  • Chain 'D':
    Compound: Cytochrome b6-f complex iron-sulfur subunit
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4h13d1, d4h13d2
  • Chain 'E':
    Compound: Cytochrome b6-f complex subunit 6
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Cytochrome b6-f complex subunit 7
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4h13f_
  • Chain 'G':
    Compound: Cytochrome b6-f complex subunit 5
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4h13g_
  • Chain 'H':
    Compound: Cytochrome b6-f complex subunit 8
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4h13h_
  • Heterogens: CD, HEM, OPC, MYS, 8K6, UMQ, TDS, CLA, 7PH, SQD, FES, BCR, OCT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h13A (A:)
    manvydwfqerleiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykp
    tvteayasvqyimnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwis
    gvilavitvsfgvtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatl
    tryysahtfvlpwliavfmllhflmirkqgisgpl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h13B (B:)
    matlkkpdlsdpklraklakgmghnyygepawpndllyvfpvvimgtfacivalsvldpa
    mvgepadpfatpleilpewylypvfqilrsvpnkllgvllmasvplglilvpfienvnkf
    qnpfrrpvattiflfgtlvtiwlgigatfpldktltlglf
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4h13D (D:)
    maqftesmdvpdmgrrqfmnllafgtvtgvalgalyplvkyfippsggavgggttakdkl
    gnnvkvskfleshnagdrvlvqglkgdptyivveskeairdyginavcthlgcvvpwnaa
    enkfkcpchgsqydetgkvirgpaplslalchatvqddnivltpwtetdfrtgekpwwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h13D (D:)
    dvpdmgrrqfmnllafgtvtgvalgalyplvkyfippsggavttakdklgnnvkvskfle
    shnagdrvlvqglkgdptyivveskeairdyginavcthlgcvvpwnaaenkfkcpchgs
    qydetgkvirgpaplslalchatvqddnivltpwtetdfrtgekpwwv
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4h13F (F:)
    mteemlyaallsfglifvgwglgvlllkiqgaeke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h13F (F:)
    teemlyaallsfglifvgwglgvlllkiqga
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h13G (G:)
    mveplldglvlglvfatlgglfyaayqqykrpnelgg
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h13H (H:)
    meidvlgwvallvvftwsiamvvwgrngl