PDB entry 4h0q

View 4h0q on RCSB PDB site
Description: Crystal structure of a acidic PLA2 from Trimeresurus stejnegeri venom
Class: hydrolase
Keywords: alpha-helix, glycerophospholipid, venom gland, HYDROLASE
Deposited on 2012-09-09, released 2012-09-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-10-15, with a file datestamp of 2014-10-10.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.179
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phospholipase A2, acid 5
  Species: Viridovipera stejnegeri [TaxId:39682]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P82896 (0-120)
    • conflict (54-55)
    • conflict (60)
    • conflict (113)
  Domains in SCOPe 2.08: d4h0qa_
• Chain 'B':
  Compound: Phospholipase A2, acid 5
  Species: Viridovipera stejnegeri [TaxId:39682]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P82896 (0-120)
    • conflict (54-55)
    • conflict (60)
    • conflict (113)
  Domains in SCOPe 2.08: d4h0qb_
• Heterogens: PEG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4h0qA (A:)
  nlmqfellimkvagrsgivwysdygcfcgkgghgrpqdatdrccfvhdccygkvngcdpk
  edfyryssnngdivceannpctkeicecdkaaaicfrdnkdtydnkywnipmescqesep
  c
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4h0qB (B:)
  nlmqfellimkvagrsgivwysdygcfcgkgghgrpqdatdrccfvhdccygkvngcdpk
  edfyryssnngdivceannpctkeicecdkaaaicfrdnkdtydnkywnipmescqesep
  c