PDB entry 4h0b

View 4h0b on RCSB PDB site
Description: Complex of G65T Myoglobin with DMSO in its Distal Cavity
Class: oxygen transport
Keywords: oxygen transport
Deposited on 2012-09-07, released 2012-11-21
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-12-12, with a file datestamp of 2012-12-07.
Experiment type: XRAY
Resolution: 1.26 Å
R-factor: 0.128
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-153)
      • engineered mutation (65)
    Domains in SCOPe 2.02: d4h0ba_
  • Heterogens: HEM, OXY, DMS, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h0bA (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkhtvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgdfgadaqgamnkalelfrkdiaakykelgyqg