PDB entry 4h07

View 4h07 on RCSB PDB site
Description: Complex of G65T Myoglobin with Phenol in its Proximal Cavity
Class: oxygen transport
Keywords: oxygen transport
Deposited on 2012-09-07, released 2012-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.14 Å
R-factor: N/A
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Physeter catodon [TaxId:9755]
  Gene: MB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185 (0-153)
    • engineered mutation (65)
  Domains in SCOPe 2.07: d4h07a_
• Heterogens: HEM, IPH, SO4, EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4h07A (A:)
  mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
  dlkkhtvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
  pgdfgadaqgamnkalelfrkdiaakykelgyqg