PDB entry 4h02

View 4h02 on RCSB PDB site
Description: Crystal structure of P. falciparum Lysyl-tRNA synthetase
Class: ligase
Keywords: Cladosporin, malaria, LIGASE
Deposited on 2012-09-07, released 2013-05-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.228
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysyl-tRNA synthetase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF13_0262
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4h02a1, d4h02a2
  • Chain 'B':
    Compound: lysyl-tRNA synthetase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF13_0262
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4h02b1, d4h02b2
  • Chain 'C':
    Compound: lysyl-tRNA synthetase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF13_0262
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4h02c1, d4h02c2
  • Chain 'D':
    Compound: lysyl-tRNA synthetase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF13_0262
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4h02d1, d4h02d2
  • Chain 'E':
    Compound: lysyl-tRNA synthetase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF13_0262
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4h02e1, d4h02e2
  • Chain 'F':
    Compound: lysyl-tRNA synthetase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF13_0262
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4h02f1, d4h02f2
  • Chain 'G':
    Compound: lysyl-tRNA synthetase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF13_0262
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4h02g1, d4h02g2
  • Chain 'H':
    Compound: lysyl-tRNA synthetase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF13_0262
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4h02h1, d4h02h2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4h02A (A:)
    evdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnit
    grimrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfp
    gkskkgelsifpketillsaclhmlpmkyglkdteiryrqryldllinessrhtfvtrtk
    iinflrnflnergffevetpmmnliagganarpfithhndldldlylriatelplkmliv
    ggidkvyeigkvfrnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgty
    kisynkdgpenqpieidftppypkvsiveeiekvtntileqpfdsnetiekminiikehk
    ielpnpptaaklldqlashfienkyndkpffivehpqimsplakyhrtkpglterlemfi
    cgkevlnaytelndpfkqkecfklqqkdrekgdteaaqldsafctsleyglpptgglglg
    idritmfltnknsikdvilfptmrpan
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h02A (A:)
    prlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitgri
    mrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgks
    kkgelsifpketillsaclhmlpmkyglkdteiryrqryldllinessrhtfvtrtkiin
    flrnflnergffevetpmmnlipfithhndldldlylriatelplkmlivggidkvyeig
    kvfrnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgtykisynkdgpe
    nqpieidftppypkvsiveeiekvtntileqpfdsnetiekminiikehkielpnpptaa
    klldqlashfienkyndkpffivehpqimsplakyhrtkpglterlemficgkevlnayt
    elndpffctsleyglpptgglglgidritmfltnknsikdvilfptmrp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4h02B (B:)
    evdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnit
    grimrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfp
    gkskkgelsifpketillsaclhmlpmkyglkdteiryrqryldllinessrhtfvtrtk
    iinflrnflnergffevetpmmnliagganarpfithhndldldlylriatelplkmliv
    ggidkvyeigkvfrnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgty
    kisynkdgpenqpieidftppypkvsiveeiekvtntileqpfdsnetiekminiikehk
    ielpnpptaaklldqlashfienkyndkpffivehpqimsplakyhrtkpglterlemfi
    cgkevlnaytelndpfkqkecfklqqkdrekgdteaaqldsafctsleyglpptgglglg
    idritmfltnknsikdvilfptmrpan
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h02B (B:)
    prlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitgri
    mrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgks
    kkgelsifpketillsaclhmlpmkyglkdteiryrqryldllinessrhtfvtrtkiin
    flrnflnergffevetpmmnlipfithhndldldlylriatelplkmlivggidkvyeig
    kvfrnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgtykisynkdgpe
    nqpieidftppypkvsiveeiekvtntileqpfdsnetiekminiikehkielpnpptaa
    klldqlashfienkyndkpffivehpqimsplakyhrtkpglterlemficgkevlnayt
    elndpfkqfctsleyglpptgglglgidritmfltnknsikdvilfptmrp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4h02C (C:)
    evdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnit
    grimrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfp
    gkskkgelsifpketillsaclhmlpmkyglkdteiryrqryldllinessrhtfvtrtk
    iinflrnflnergffevetpmmnliagganarpfithhndldldlylriatelplkmliv
    ggidkvyeigkvfrnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgty
    kisynkdgpenqpieidftppypkvsiveeiekvtntileqpfdsnetiekminiikehk
    ielpnpptaaklldqlashfienkyndkpffivehpqimsplakyhrtkpglterlemfi
    cgkevlnaytelndpfkqkecfklqqkdrekgdteaaqldsafctsleyglpptgglglg
    idritmfltnknsikdvilfptmrpan
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h02C (C:)
    prlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitgri
    mrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgks
    kkgelsifpketillsaclhmlpmkyglkdteiryrqryldllinessrhtfvtrtkiin
    flrnflnergffevetpmmnlipfithhndldldlylriatelplkmlivggidkvyeig
    kvfrnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgtykisynkdgpe
    nqpieidftppypkvsiveeiekvtntileqpfdsnetiekminiikehkielpnpptaa
    klldqlashfienkyndkpffivehpqimsplakyhrtkpglterlemficgkevlnayt
    elndpffctsleyglpptgglglgidritmfltnknsikdvilfptmrpan
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4h02D (D:)
    evdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnit
    grimrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfp
    gkskkgelsifpketillsaclhmlpmkyglkdteiryrqryldllinessrhtfvtrtk
    iinflrnflnergffevetpmmnliagganarpfithhndldldlylriatelplkmliv
    ggidkvyeigkvfrnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgty
    kisynkdgpenqpieidftppypkvsiveeiekvtntileqpfdsnetiekminiikehk
    ielpnpptaaklldqlashfienkyndkpffivehpqimsplakyhrtkpglterlemfi
    cgkevlnaytelndpfkqkecfklqqkdrekgdteaaqldsafctsleyglpptgglglg
    idritmfltnknsikdvilfptmrpan
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h02D (D:)
    prlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitgri
    mrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgks
    kkgelsifpketillsaclhmlpmkyglkdteiryrqryldllinessrhtfvtrtkiin
    flrnflnergffevetpmmnlipfithhndldldlylriatelplkmlivggidkvyeig
    kvfrnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgtykisynkdgpe
    nqpieidftppypkvsiveeiekvtntileqpfdsnetiekminiikehkielpnpptaa
    klldqlashfienkyndkpffivehpqimsplakyhrtkpglterlemficgkevlnayt
    elndpfkqfctsleyglpptgglglgidritmfltnknsikdvilfptmrp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4h02E (E:)
    evdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnit
    grimrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfp
    gkskkgelsifpketillsaclhmlpmkyglkdteiryrqryldllinessrhtfvtrtk
    iinflrnflnergffevetpmmnliagganarpfithhndldldlylriatelplkmliv
    ggidkvyeigkvfrnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgty
    kisynkdgpenqpieidftppypkvsiveeiekvtntileqpfdsnetiekminiikehk
    ielpnpptaaklldqlashfienkyndkpffivehpqimsplakyhrtkpglterlemfi
    cgkevlnaytelndpfkqkecfklqqkdrekgdteaaqldsafctsleyglpptgglglg
    idritmfltnknsikdvilfptmrpan
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h02E (E:)
    prlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitgri
    mrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgks
    kkgelsifpketillsaclhmlpmkyglkdteiryrqryldllinessrhtfvtrtkiin
    flrnflnergffevetpmmnlipfithhndldldlylriatelplkmlivggidkvyeig
    kvfrnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgtykisynkdgpe
    nqpieidftppypkvsiveeiekvtntileqpfdsnetiekminiikehkielpnpptaa
    klldqlashfienkyndkpffivehpqimsplakyhrtkpglterlemficgkevlnayt
    elndpfkfctsleyglpptgglglgidritmfltnknsikdvilfptmrp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4h02F (F:)
    evdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnit
    grimrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfp
    gkskkgelsifpketillsaclhmlpmkyglkdteiryrqryldllinessrhtfvtrtk
    iinflrnflnergffevetpmmnliagganarpfithhndldldlylriatelplkmliv
    ggidkvyeigkvfrnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgty
    kisynkdgpenqpieidftppypkvsiveeiekvtntileqpfdsnetiekminiikehk
    ielpnpptaaklldqlashfienkyndkpffivehpqimsplakyhrtkpglterlemfi
    cgkevlnaytelndpfkqkecfklqqkdrekgdteaaqldsafctsleyglpptgglglg
    idritmfltnknsikdvilfptmrpan
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h02F (F:)
    prlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitgri
    mrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgks
    kkgelsifpketillsaclhmlpmkyglkdteiryrqryldllinessrhtfvtrtkiin
    flrnflnergffevetpmmnlipfithhndldldlylriatelplkmlivggidkvyeig
    kvfrnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgtykisynkdgpe
    nqpieidftppypkvsiveeiekvtntileqpfdsnetiekminiikehkielpnpptaa
    klldqlashfienkyndkpffivehpqimsplakyhrtkpglterlemficgkevlnayt
    elndpfkfctsleyglpptgglglgidritmfltnknsikdvilfptmrp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4h02G (G:)
    evdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnit
    grimrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfp
    gkskkgelsifpketillsaclhmlpmkyglkdteiryrqryldllinessrhtfvtrtk
    iinflrnflnergffevetpmmnliagganarpfithhndldldlylriatelplkmliv
    ggidkvyeigkvfrnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgty
    kisynkdgpenqpieidftppypkvsiveeiekvtntileqpfdsnetiekminiikehk
    ielpnpptaaklldqlashfienkyndkpffivehpqimsplakyhrtkpglterlemfi
    cgkevlnaytelndpfkqkecfklqqkdrekgdteaaqldsafctsleyglpptgglglg
    idritmfltnknsikdvilfptmrpan
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h02G (G:)
    prlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitgri
    mrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgks
    kkgelsifpketillsaclhmlpmkyglkdteiryrqryldllinessrhtfvtrtkiin
    flrnflnergffevetpmmnlipfithhndldldlylriatelplkmlivggidkvyeig
    kvfrnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgtykisynkdgpe
    nqpieidftppypkvsiveeiekvtntileqpfdsnetiekminiikehkielpnpptaa
    klldqlashfienkyndkpffivehpqimsplakyhrtkpglterlemficgkevlnayt
    elndpfkfctsleyglpptgglglgidritmfltnknsikdvilfptmrp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4h02H (H:)
    evdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnit
    grimrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfp
    gkskkgelsifpketillsaclhmlpmkyglkdteiryrqryldllinessrhtfvtrtk
    iinflrnflnergffevetpmmnliagganarpfithhndldldlylriatelplkmliv
    ggidkvyeigkvfrnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgty
    kisynkdgpenqpieidftppypkvsiveeiekvtntileqpfdsnetiekminiikehk
    ielpnpptaaklldqlashfienkyndkpffivehpqimsplakyhrtkpglterlemfi
    cgkevlnaytelndpfkqkecfklqqkdrekgdteaaqldsafctsleyglpptgglglg
    idritmfltnknsikdvilfptmrpan
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h02H (H:)
    prlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitgri
    mrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgks
    kkgelsifpketillsaclhmlpmkyglkdteiryrqryldllinessrhtfvtrtkiin
    flrnflnergffevetpmmnlipfithhndldldlylriatelplkmlivggidkvyeig
    kvfrnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgtykisynkdgpe
    nqpieidftppypkvsiveeiekvtntileqpfdsnetiekminiikehkielpnpptaa
    klldqlashfienkyndkpffivehpqimsplakyhrtkpglterlemficgkevlnayt
    elndpfkqfctsleyglpptgglglgidritmfltnknsikdvilfptmrp