PDB entry 4gzf

View 4gzf on RCSB PDB site
Description: Multi-drug resistant HIV-1 protease 769 variant with reduced LrF peptide
Class: hydrolase/hydrolase inhibitor
Keywords: Multi-drug resistance, Protease inhibitor, Drug resistance, substrate peptides, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-09-06, released 2013-10-30
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-11-13, with a file datestamp of 2013-11-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.199
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9QM22 (0-98)
    • engineered mutation (6)
    • engineered mutation (24)
    • engineered mutation (35)
    • engineered mutation (81)
    • engineered mutation (83)
  Domains in SCOPe 2.03: d4gzfa_
• Chain 'B':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9QM22 (0-98)
    • engineered mutation (6)
    • engineered mutation (24)
    • engineered mutation (35)
    • engineered mutation (81)
    • engineered mutation (83)
  Domains in SCOPe 2.03: d4gzfb_
• Chain 'C':
  Compound: LrF peptide
  Database cross-references and differences (RAF-indexed):
  • PDB 4GZF (0-5)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4gzfA (A:)
  pqitlwkrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
  qvpieicghkvigtvlvgptptnvigrnlmtqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4gzfB (B:)
  pqitlwkrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
  qvpieicghkvigtvlvgptptnvigrnlmtqigctlnf
  

  
  
• Chain 'C':
  No sequence available.