PDB entry 4gyq

View 4gyq on RCSB PDB site
Description: Crystal Structure of New Delhi Metallo-beta-Lactamase-1 D223A mutant from Klebsiella pneumoniae
Class: hydrolase
Keywords: Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, Structures of Mtb Proteins Conferring Susceptibility to Known Mtb Inhibitors, MTBI, alpha-beta-beta-alpha fold, hydrolase
Deposited on 2012-09-05, released 2012-09-26
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-09-26, with a file datestamp of 2012-09-21.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.145
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Beta-lactamase NDM-1
  Species: Klebsiella pneumoniae [TaxId:573]
  Gene: blaNDM-1
  Database cross-references and differences (RAF-indexed):
  • Uniprot C7C422 (Start-242)
    • engineered mutation (195)
• Chain 'B':
  Compound: Beta-lactamase NDM-1
  Species: Klebsiella pneumoniae [TaxId:573]
  Gene: blaNDM-1
  Database cross-references and differences (RAF-indexed):
  • Uniprot C7C422 (Start-242)
    • engineered mutation (195)
• Chain 'C':
  Compound: Beta-lactamase NDM-1
  Species: Klebsiella pneumoniae [TaxId:573]
  Gene: blaNDM-1
  Database cross-references and differences (RAF-indexed):
  • Uniprot C7C422 (Start-242)
    • engineered mutation (195)
  Domains in SCOPe 2.02: d4gyqc_
• Chain 'D':
  Compound: Beta-lactamase NDM-1
  Species: Klebsiella pneumoniae [TaxId:573]
  Gene: blaNDM-1
  Database cross-references and differences (RAF-indexed):
  • Uniprot C7C422 (Start-242)
    • engineered mutation (195)
• Heterogens: EDO, MG, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >4gyqC (C:)
  snairptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvl
  vvdtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnq
  lapqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafgg
  clikdskakslgnlgaadtehyaasarafgaafpkasmivmshsapdsraaithtarmad
  klr
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4gyqC (C:)
  tigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtaw
  tddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqeg
  mvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikds
  kakslgnlgaadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
  

  
  
• Chain 'D':
  No sequence available.