PDB entry 4gy9

View 4gy9 on RCSB PDB site
Description: Crystal Structure of Medicago truncatula Nodulin 13 (MtN13) in complex with N6-isopentenyladenine (2iP)
Class: plant protein
Keywords: PR-10 FOLD, nodulin, nodulation, legume plant-rhizobium symbiosis, cytokinin binding, PLANT PROTEIN
Deposited on 2012-09-05, released 2013-09-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-12-04, with a file datestamp of 2013-11-29.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.167
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MtN13 protein
    Species: Medicago truncatula [TaxId:3880]
    Gene: MtN13
    Database cross-references and differences (RAF-indexed):
    • Uniprot P93330 (5-End)
      • expression tag (0-4)
    Domains in SCOPe 2.03: d4gy9a_
  • Heterogens: ZIP, NA, MLI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gy9A (A:)
    idpftmgvitseseyvsslsaeklyrgivedgniiypkalprfiekaetlegdggpgtik
    kltfvgdfgstkqhidmvdrencaytysvyegialsdqplekivfefklvptpeegcivk
    sttkyytkgddielskdyleagierfegftkavesfllanpdynkdsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gy9A (A:)
    idpftmgvitseseyvsslsaeklyrgivedgniiypkalprfiekaetlegdggpgtik
    kltfvgdfgstkqhidmvdrencaytysvyegialsdqplekivfefklvptpeegcivk
    sttkyytkgddielskdyleagierfegftkavesfllanpdy