PDB entry 4gy3

View 4gy3 on RCSB PDB site
Description: T. vulcanus Phycocyanin crystallized in 2M Urea
Class: photosynthesis
Keywords: Photosynthesis, light harvesting, urea denaturation, globin-type, Photosynthetic antenna, N-methyl asparagine, phycocyanoblilin, membrane attached
Deposited on 2012-09-05, released 2013-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.225
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c-phycocyanin alpha subunit
    Species: Thermosynechococcus vulcanus [TaxId:32053]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gy3a_
  • Chain 'B':
    Compound: c-phycocyanin beta subunit
    Species: Thermosynechococcus vulcanus [TaxId:32053]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gy3b_
  • Heterogens: CYC, URE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gy3A (A:)
    mktpiteaiaaadtqgrflsntelqavdgrfkravasmeaaraltnnaqslidgaaqavy
    qkfpytttmqgsqyastpegkakcardigyylrmityclvaggtgpmdeyliaglseins
    tfdlspswyiealkyikanhgltgqaaveanayidyainals
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gy3B (B:)
    mldafakvvaqadargefltnaqfdalsnlvkegnkrldavnritsnastivanaaralf
    aeqpqliqpggnaytnrrmaaclrdmeiilryvtyailagdssvlddrclnglretyqal
    gtpgssvavaiqkmkdaaiaiandpngitpgdcsalmseiagyfdraaaava