PDB entry 4gxx

View 4gxx on RCSB PDB site
Description: Crystal structure of the "avianized" 1918 influenza virus hemagglutinin
Class: viral protein
Keywords: viral fusion protein, virus attachment and entry, VIRAL PROTEIN
Deposited on 2012-09-04, released 2012-12-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-12-26, with a file datestamp of 2012-12-21.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.182
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:88776]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WFX3 (4-End)
      • expression tag (3)
      • engineered mutation (190)
      • engineered mutation (225)
    Domains in SCOPe 2.03: d4gxxa_
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:88776]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:88776]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WFX3 (4-End)
      • engineered mutation (190)
      • engineered mutation (225)
    Domains in SCOPe 2.03: d4gxxc_
  • Chain 'D':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:88776]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:88776]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WFX3 (4-End)
      • expression tag (2-3)
      • engineered mutation (190)
      • engineered mutation (225)
    Domains in SCOPe 2.03: d4gxxe_
  • Chain 'F':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:88776]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gxxA (A:)
    adpgdticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcn
    iagwllgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfei
    fpktsswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvl
    wgvhhpptgteqqslyqnadayvsvgsskynrrftpeiaarpkvrgqagrmnyywtllep
    gdtitfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnih
    pvtigecpkyvrstklrmatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gxxA (A:)
    gdticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniag
    wllgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpk
    tsswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgv
    hhpptgteqqslyqnadayvsvgsskynrrftpeiaarpkvrgqagrmnyywtllepgdt
    itfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvt
    igecpkyvrstklrmatglrnip
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4gxxC (C:)
    adpgdticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcn
    iagwllgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfei
    fpktsswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvl
    wgvhhpptgteqqslyqnadayvsvgsskynrrftpeiaarpkvrgqagrmnyywtllep
    gdtitfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnih
    pvtigecpkyvrstklrmatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gxxC (C:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniagw
    llgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpkt
    sswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgvh
    hpptgteqqslyqnadayvsvgsskynrrftpeiaarpkvrgqagrmnyywtllepgdti
    tfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvti
    gecpkyvrstklrmatglrnips
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4gxxE (E:)
    adpgdticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcn
    iagwllgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfei
    fpktsswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvl
    wgvhhpptgteqqslyqnadayvsvgsskynrrftpeiaarpkvrgqagrmnyywtllep
    gdtitfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnih
    pvtigecpkyvrstklrmatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gxxE (E:)
    pgdticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcnia
    gwllgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifp
    ktsswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwg
    vhhpptgteqqslyqnadayvsvgsskynrrftpeiaarpkvrgqagrmnyywtllepgd
    titfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpv
    tigecpkyvrstklrmatglrnips
    

  • Chain 'F':
    No sequence available.