PDB entry 4gxp

View 4gxp on RCSB PDB site
Description: Chimeric Family 1 beta-glucosidase made with non-contiguous SCHEMA
Class: hydrolase
Keywords: chimeragenesis, protein recombination, eukaryotic-prokaryotic chimera, GH1, beta-glucosidase, HYDROLASE
Deposited on 2012-09-04, released 2013-01-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.242
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase Chimeric protein
    Species: Thermotoga maritima, Trichoderma reesei [TaxId:243274, 51453]
    Gene: bglA, bgl2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08638 (Start-166)
      • engineered mutation (126)
      • engineered mutation (140-141)
    • Uniprot Q08638 (210-223)
    • Uniprot Q08638 (371-399)
      • engineered mutation (397)
    • Uniprot Q08638 (415-End)
    • Uniprot O93785 (167-209)
    • Uniprot O93785 (224-370)
      • engineered mutation (339-340)
    • Uniprot O93785 (400-414)
    Domains in SCOPe 2.06: d4gxpa_
  • Chain 'B':
    Compound: Beta-glucosidase Chimeric protein
    Species: Thermotoga maritima, Trichoderma reesei [TaxId:243274, 51453]
    Gene: bglA, bgl2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08638 (Start-166)
      • engineered mutation (126)
      • engineered mutation (140-141)
    • Uniprot Q08638 (210-223)
    • Uniprot Q08638 (371-399)
      • engineered mutation (397)
    • Uniprot Q08638 (415-End)
    • Uniprot O93785 (167-209)
    • Uniprot O93785 (224-370)
      • engineered mutation (339-340)
    • Uniprot O93785 (400-414)
    Domains in SCOPe 2.06: d4gxpb_
  • Chain 'C':
    Compound: Beta-glucosidase Chimeric protein
    Species: Thermotoga maritima, Trichoderma reesei [TaxId:243274, 51453]
    Gene: bglA, bgl2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08638 (Start-166)
      • engineered mutation (126)
      • engineered mutation (140-141)
    • Uniprot Q08638 (210-223)
    • Uniprot Q08638 (371-399)
      • engineered mutation (397)
    • Uniprot Q08638 (415-466)
    • Uniprot O93785 (167-209)
    • Uniprot O93785 (224-370)
      • engineered mutation (339-340)
    • Uniprot O93785 (400-414)
    Domains in SCOPe 2.06: d4gxpc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gxpA (A:)
    mhhhhhhmnvkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdv
    acdhynrwkedieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgi
    tpfvtifhwdlpfalqlkggllnreiadwfaeysrvlfenfgdrvknwitfneplcsaip
    gygsgtfapgrqstsepwtvghnilvahgravkvfretvkdgkigivlngdftypwdaad
    padkeaaerrlefftawfadpiylgdypasmrkqlgdrlptftpeeralvhgsndfygmn
    hytsnyirhrsspasaddtvgnvdvlftnkqgncigpetampwlrpcaagfrdflvwisk
    rygyppiyvtengaafddvvsedgrvhdqnridylkayigamvtaveldgvnvkgyfvws
    lldnfewaegyskrfgivyvdystqkrivkdsgywysnvvknngled
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gxpA (A:)
    kkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwke
    dieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtifhwd
    lpfalqlkggllnreiadwfaeysrvlfenfgdrvknwitfneplcsaipgygsgtfapg
    rqstsepwtvghnilvahgravkvfretvkdgkigivlngdftypwdaadpadkeaaerr
    lefftawfadpiylgdypasmrkqlgdrlptftpeeralvhgsndfygmnhytsnyirhr
    sspasaddtvgnvdvlftnkqgncigpetampwlrpcaagfrdflvwiskrygyppiyvt
    engaafddvvsedgrvhdqnridylkayigamvtaveldgvnvkgyfvwslldnfewaeg
    yskrfgivyvdystqkrivkdsgywysnvvknngle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gxpB (B:)
    mhhhhhhmnvkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdv
    acdhynrwkedieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgi
    tpfvtifhwdlpfalqlkggllnreiadwfaeysrvlfenfgdrvknwitfneplcsaip
    gygsgtfapgrqstsepwtvghnilvahgravkvfretvkdgkigivlngdftypwdaad
    padkeaaerrlefftawfadpiylgdypasmrkqlgdrlptftpeeralvhgsndfygmn
    hytsnyirhrsspasaddtvgnvdvlftnkqgncigpetampwlrpcaagfrdflvwisk
    rygyppiyvtengaafddvvsedgrvhdqnridylkayigamvtaveldgvnvkgyfvws
    lldnfewaegyskrfgivyvdystqkrivkdsgywysnvvknngled
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gxpB (B:)
    kkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwke
    dieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtifhwd
    lpfalqlkggllnreiadwfaeysrvlfenfgdrvknwitfneplcsaipgygsgtfapg
    rqstsepwtvghnilvahgravkvfretvkdgkigivlngdftypwdaadpadkeaaerr
    lefftawfadpiylgdypasmrkqlgdrlptftpeeralvhgsndfygmnhytsnyirhr
    sspasaddtvgnvdvlftnkqgncigpetampwlrpcaagfrdflvwiskrygyppiyvt
    engaafddvvsedgrvhdqnridylkayigamvtaveldgvnvkgyfvwslldnfewaeg
    yskrfgivyvdystqkrivkdsgywysnvvknngle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4gxpC (C:)
    mhhhhhhmnvkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdv
    acdhynrwkedieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgi
    tpfvtifhwdlpfalqlkggllnreiadwfaeysrvlfenfgdrvknwitfneplcsaip
    gygsgtfapgrqstsepwtvghnilvahgravkvfretvkdgkigivlngdftypwdaad
    padkeaaerrlefftawfadpiylgdypasmrkqlgdrlptftpeeralvhgsndfygmn
    hytsnyirhrsspasaddtvgnvdvlftnkqgncigpetampwlrpcaagfrdflvwisk
    rygyppiyvtengaafddvvsedgrvhdqnridylkayigamvtaveldgvnvkgyfvws
    lldnfewaegyskrfgivyvdystqkrivkdsgywysnvvknngled
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gxpC (C:)
    kkfpegflwgvatasyqegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwked
    ieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtifhwdl
    pfalqlkggllnreiadwfaeysrvlfenfgdrvknwitfneplcsaipgygsgtfapgr
    qstsepwtvghnilvahgravkvfretvkdgkigivlngdftypwdaadpadkeaaerrl
    efftawfadpiylgdypasmrkqlgdrlptftpeeralvhgsndfygmnhytsnyirhrs
    spasaddtvgnvdvlftnkqgncigpetampwlrpcaagfrdflvwiskrygyppiyvte
    ngaafddvvsedgrvhdqnridylkayigamvtaveldgvnvkgyfvwslldnfewaegy
    skrfgivyvystqrivkdsgywysnvvknngled