PDB entry 4gxg

View 4gxg on RCSB PDB site
Description: Crystal structure of human GLTP bound with 12:0 monosulfatide (orthorhombic form; four subunits in asymmetric unit)
Class: lipid transport
Keywords: GLTP-fold, lipid transport
Deposited on 2012-09-04, released 2013-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-10, with a file datestamp of 2013-04-05.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.21
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycolipid transfer protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GLTP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gxga_
  • Chain 'B':
    Compound: glycolipid transfer protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GLTP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gxgb_
  • Chain 'D':
    Compound: glycolipid transfer protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GLTP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gxgd_
  • Chain 'E':
    Compound: glycolipid transfer protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GLTP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gxge_
  • Heterogens: EIS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gxgA (A:)
    mallaehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavy
    dtnpakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenh
    pnlirvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeecleki
    rlflvnytatidviyemytqmnaelnykv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gxgB (B:)
    mallaehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavy
    dtnpakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenh
    pnlirvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeecleki
    rlflvnytatidviyemytqmnaelnykv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gxgB (B:)
    llaehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydt
    npakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpn
    lirvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekirl
    flvnytatidviyemytqmnaelnykv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4gxgD (D:)
    mallaehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavy
    dtnpakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenh
    pnlirvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeecleki
    rlflvnytatidviyemytqmnaelnykv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gxgD (D:)
    laehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtn
    pakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnl
    irvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekirlf
    lvnytatidviyemytqmnaelnykv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4gxgE (E:)
    mallaehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavy
    dtnpakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenh
    pnlirvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeecleki
    rlflvnytatidviyemytqmnaelnykv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gxgE (E:)
    allaehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavyd
    tnpakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhp
    nlirvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekir
    lflvnytatidviyemytqmnaelnykv