PDB entry 4gxd

View 4gxd on RCSB PDB site
Description: Crystal structure of D48V mutant of human GLTP bound with 12:0 disulfatide
Class: lipid transport
Keywords: GLTP-fold, lipid transport
Deposited on 2012-09-04, released 2013-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-10, with a file datestamp of 2013-04-05.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.186
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycolipid transfer protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GLTP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZD2 (Start-208)
      • engineered mutation (47)
    Domains in SCOPe 2.07: d4gxda_
  • Heterogens: 0SG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gxdA (A:)
    mallaehllkplpadkqietgpfleavshlppffdclgspvftpikavisgnitkikavy
    dtnpakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenh
    pnlirvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeecleki
    rlflvnytatidviyemytqmnaelnykv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gxdA (A:)
    kplpadkqietgpfleavshlppffdclgspvftpikavisgnitkikavydtnpakfrt
    lqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnlirvnat
    kayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekirlflvnyta
    tidviyemytqmnaelnykv