PDB entry 4gwg

View 4gwg on RCSB PDB site
Description: Crystal Structure Analysis of 6-phosphogluconate dehydrogenase apo-form
Class: oxidoreductase
Keywords: 6-phosphoglyconate dehydrogenase, dehydrogenase, NADP, OXIDOREDUCTASE
Deposited on 2012-09-03, released 2012-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-12-05, with a file datestamp of 2012-11-30.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: 0.17
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-phosphogluconate dehydrogenase, decarboxylating
    Species: Homo sapiens [TaxId:9606]
    Gene: PGD, PGDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4gwga1, d4gwga2
  • Heterogens: MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gwgA (A:)
    snaqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvvgaqslk
    emvsklkkprriillvkagqavddfieklvplldtgdiiidggnseyrdttrrcrdlkak
    gilfvgsgvsggeegarygpslmpggnkeawphiktifqgiaakvgtgepccdwvgdega
    ghfvkmvhngieygdmqliceayhlmkdvlgmaqdemaqafedwnkteldsflieitani
    lkfqdtdgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslkderiq
    askklkgpqkfqfdgdkksfledirkalyaskiisyaqgfmllrqaatefgwtlnyggia
    lmwrggciirsvflgkikdafdrnpelqnlllddffksavencqdswrravstgvqagip
    mpcfttalsfydgyrhemlpasliqaqrdyfgahtyellakpgqfihtnwtghggtvsss
    syna
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gwgA (A:)
    aqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvvgaqslkem
    vsklkkprriillvkagqavddfieklvplldtgdiiidggnseyrdttrrcrdlkakgi
    lfvgsgvsggeegarygpslmpggnkeawphiktifqgiaakvgtgepccdwvgdegagh
    fvkmvhngieygdmqliceayhlmkdvlgmaqdemaqafedwnkteldsflieitanilk
    fqdtdgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslkderiqas
    kklkgpfqfdgdkksfledirkalyaskiisyaqgfmllrqaatefgwtlnyggialmwr
    ggciirsvflgkikdafdrnpelqnlllddffksavencqdswrravstgvqagipmpcf
    ttalsfydgyrhemlpasliqaqrdyfgahtyellakpgqfihtnwt